Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | bsrE-as-bsrE/- |
| Location | 1887013..1887259 | Replicon | chromosome |
| Accession | NZ_CP116869 | ||
| Organism | Bacillus subtilis subsp. subtilis strain MGP001 | ||
Toxin (Protein)
| Gene name | bsrE | Uniprot ID | - |
| Locus tag | PPM34_RS09375 | Protein ID | WP_109789044.1 |
| Coordinates | 1887013..1887105 (+) | Length | 31 a.a. |
Antitoxin (RNA)
| Gene name | as-bsrE | ||
| Locus tag | - | ||
| Coordinates | 1887086..1887259 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PPM34_RS09360 | 1882172..1882507 | + | 336 | WP_009967409.1 | hypothetical protein | - |
| PPM34_RS09365 | 1882554..1886159 | - | 3606 | WP_004399367.1 | P-loop NTPase fold protein | - |
| PPM34_RS09370 | 1886392..1886724 | - | 333 | WP_026009814.1 | hypothetical protein | - |
| PPM34_RS09375 | 1887013..1887105 | + | 93 | WP_109789044.1 | type I toxin-antitoxin system toxin BsrE | Toxin |
| - | 1887086..1887259 | - | 174 | - | - | Antitoxin |
| PPM34_RS09380 | 1887374..1888216 | - | 843 | WP_003231327.1 | hypothetical protein | - |
| PPM34_RS09385 | 1888416..1888874 | - | 459 | WP_003231326.1 | type VII secretion system immunity protein YobK | - |
| PPM34_RS09390 | 1888884..1890686 | - | 1803 | WP_004399481.1 | LXG family T7SS effector ribonuclease toxin YobL | - |
| PPM34_RS09395 | 1890788..1891345 | - | 558 | WP_004399321.1 | SMI1/KNR4 family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1872998..1896676 | 23678 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 31 a.a. Molecular weight: 3358.16 Da Isoelectric Point: 4.1840
>T269294 WP_109789044.1 NZ_CP116869:1887013-1887105 [Bacillus subtilis subsp. subtilis]
MSTFQALMLMLAIGSFIIALLTYIEKIDLP
MSTFQALMLMLAIGSFIIALLTYIEKIDLP
Download Length: 93 bp
Antitoxin
Download Length: 174 bp
>AT269294 NZ_CP116869:c1887259-1887086 [Bacillus subtilis subsp. subtilis]
TTACAATACATTACAGTGCATTTCTTTAATGAGAAATGCATAAAATAAAAAAGACCGAGGTGCTACCAACACCCCGGCTC
TGTACAAAAAGTTGCCCATCAAAGGGCTTGCTCGATGTGGTTCTAGGTAGGCCTATCCCTTCAGGTTCTGAGGCTCAAGG
GAGGTCTATTTTTT
TTACAATACATTACAGTGCATTTCTTTAATGAGAAATGCATAAAATAAAAAAGACCGAGGTGCTACCAACACCCCGGCTC
TGTACAAAAAGTTGCCCATCAAAGGGCTTGCTCGATGTGGTTCTAGGTAGGCCTATCCCTTCAGGTTCTGAGGCTCAAGG
GAGGTCTATTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|