Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | bsrE-as-bsrE/- |
| Location | 1720048..1720294 | Replicon | chromosome |
| Accession | NZ_CP116864 | ||
| Organism | Bacillus subtilis subsp. subtilis strain MGP022 | ||
Toxin (Protein)
| Gene name | bsrE | Uniprot ID | - |
| Locus tag | PPM28_RS08790 | Protein ID | WP_109789044.1 |
| Coordinates | 1720048..1720140 (+) | Length | 31 a.a. |
Antitoxin (RNA)
| Gene name | as-bsrE | ||
| Locus tag | - | ||
| Coordinates | 1720121..1720294 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PPM28_RS08775 | 1715207..1715542 | + | 336 | WP_009967409.1 | hypothetical protein | - |
| PPM28_RS08780 | 1715589..1719194 | - | 3606 | WP_004399367.1 | P-loop NTPase fold protein | - |
| PPM28_RS08785 | 1719427..1719759 | - | 333 | WP_026009814.1 | hypothetical protein | - |
| PPM28_RS08790 | 1720048..1720140 | + | 93 | WP_109789044.1 | type I toxin-antitoxin system toxin BsrE | Toxin |
| - | 1720121..1720294 | - | 174 | - | - | Antitoxin |
| PPM28_RS08795 | 1720409..1721251 | - | 843 | WP_003231327.1 | hypothetical protein | - |
| PPM28_RS08800 | 1721451..1721909 | - | 459 | WP_003231326.1 | type VII secretion system immunity protein YobK | - |
| PPM28_RS08805 | 1721919..1723721 | - | 1803 | WP_004399481.1 | LXG family T7SS effector ribonuclease toxin YobL | - |
| PPM28_RS08810 | 1723823..1724380 | - | 558 | WP_004399321.1 | SMI1/KNR4 family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1706033..1750516 | 44483 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 31 a.a. Molecular weight: 3358.16 Da Isoelectric Point: 4.1840
>T269274 WP_109789044.1 NZ_CP116864:1720048-1720140 [Bacillus subtilis subsp. subtilis]
MSTFQALMLMLAIGSFIIALLTYIEKIDLP
MSTFQALMLMLAIGSFIIALLTYIEKIDLP
Download Length: 93 bp
Antitoxin
Download Length: 174 bp
>AT269274 NZ_CP116864:c1720294-1720121 [Bacillus subtilis subsp. subtilis]
TTACAATACATTACAGTGCATTTCTTTAATGAGAAATGCATAAAATAAAAAAGACCGAGGTGCTACCAACACCCCGGCTC
TGTACAAAAAGTTGCCCATCAAAGGGCTTGCTCGATGTGGTTCTAGGTAGGCCTATCCCTTCAGGTTCTGAGGCTCAAGG
GAGGTCTATTTTTT
TTACAATACATTACAGTGCATTTCTTTAATGAGAAATGCATAAAATAAAAAAGACCGAGGTGCTACCAACACCCCGGCTC
TGTACAAAAAGTTGCCCATCAAAGGGCTTGCTCGATGTGGTTCTAGGTAGGCCTATCCCTTCAGGTTCTGAGGCTCAAGG
GAGGTCTATTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|