Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/- |
Location | 5104361..5105022 | Replicon | chromosome |
Accession | NZ_CP116775 | ||
Organism | Pseudomonas sp. 273 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | PKO50_RS23225 | Protein ID | WP_275627345.1 |
Coordinates | 5104675..5105022 (-) | Length | 116 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | PKO50_RS23220 | Protein ID | WP_089391836.1 |
Coordinates | 5104361..5104678 (-) | Length | 106 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PKO50_RS23195 | 5099402..5100166 | - | 765 | WP_089391832.1 | arginine/ornithine transport ATP-binding protein AotP | - |
PKO50_RS23200 | 5100182..5101294 | - | 1113 | WP_275627344.1 | M14 family metallopeptidase | - |
PKO50_RS23205 | 5101311..5102009 | - | 699 | WP_089391834.1 | ABC transporter permease | - |
PKO50_RS23210 | 5102023..5102712 | - | 690 | WP_109931925.1 | ABC transporter permease | - |
PKO50_RS23215 | 5102881..5103660 | - | 780 | WP_009620740.1 | ABC transporter substrate-binding protein | - |
PKO50_RS23220 | 5104361..5104678 | - | 318 | WP_089391836.1 | transcriptional regulator | Antitoxin |
PKO50_RS23225 | 5104675..5105022 | - | 348 | WP_275627345.1 | toxin | Toxin |
PKO50_RS23230 | 5105181..5107136 | - | 1956 | WP_275627346.1 | acetate--CoA ligase | - |
PKO50_RS23235 | 5107286..5108566 | - | 1281 | WP_109931917.1 | C4-dicarboxylate TRAP transporter large permease protein DctM | - |
PKO50_RS23240 | 5108563..5109195 | - | 633 | WP_109931915.1 | TRAP transporter small permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 13320.24 Da Isoelectric Point: 10.1328
>T269244 WP_275627345.1 NZ_CP116775:c5105022-5104675 [Pseudomonas sp. 273]
MKAAFVELSPFERNRRHYLDDEAFRLFQQLLLARPDAGDVIAGTGGLRKVRFGDPGRGKGRRGGLRVIYYCWLGSAQFWL
FTLYDKDEQDDLNERQRNQLAVLLQAELKSRGMVR
MKAAFVELSPFERNRRHYLDDEAFRLFQQLLLARPDAGDVIAGTGGLRKVRFGDPGRGKGRRGGLRVIYYCWLGSAQFWL
FTLYDKDEQDDLNERQRNQLAVLLQAELKSRGMVR
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|