Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
Location | 494767..495467 | Replicon | chromosome |
Accession | NZ_CP116775 | ||
Organism | Pseudomonas sp. 273 |
Toxin (Protein)
Gene name | mqsR | Uniprot ID | - |
Locus tag | PKO50_RS02340 | Protein ID | WP_275628696.1 |
Coordinates | 494767..495063 (+) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | mqsA | Uniprot ID | - |
Locus tag | PKO50_RS02345 | Protein ID | WP_089389665.1 |
Coordinates | 495066..495467 (+) | Length | 134 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PKO50_RS02310 | 491019..491906 | - | 888 | WP_109933205.1 | methylisocitrate lyase | - |
PKO50_RS02315 | 491903..492625 | - | 723 | WP_089389670.1 | GntR family transcriptional regulator | - |
PKO50_RS02320 | 492822..493433 | + | 612 | WP_275628694.1 | class I SAM-dependent methyltransferase | - |
PKO50_RS02325 | 493441..493680 | - | 240 | WP_009615991.1 | hypothetical protein | - |
PKO50_RS02330 | 493846..494076 | - | 231 | WP_009615992.1 | hypothetical protein | - |
PKO50_RS02335 | 494188..494640 | - | 453 | WP_275628695.1 | hypothetical protein | - |
PKO50_RS02340 | 494767..495063 | + | 297 | WP_275628696.1 | type II toxin-antitoxin system MqsR family toxin | Toxin |
PKO50_RS02345 | 495066..495467 | + | 402 | WP_089389665.1 | type II toxin-antitoxin system MqsA family antitoxin | Antitoxin |
PKO50_RS02350 | 495919..497247 | - | 1329 | WP_109934197.1 | sigma-54 dependent transcriptional regulator | - |
PKO50_RS02355 | 497244..499130 | - | 1887 | WP_275628697.1 | sensor histidine kinase | - |
PKO50_RS02360 | 499333..500067 | - | 735 | WP_089389662.1 | amino acid ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 10926.68 Da Isoelectric Point: 8.9848
>T269235 WP_275628696.1 NZ_CP116775:494767-495063 [Pseudomonas sp. 273]
MEKSTPHCRLDRVKSLLAQGRVRATYSALSGGAVLGLDFADMLAVIEALAPRDFHKSMTTHADHRVWQDVYRPSTAVGRI
YLKLTVIDDVLVVSFKEL
MEKSTPHCRLDRVKSLLAQGRVRATYSALSGGAVLGLDFADMLAVIEALAPRDFHKSMTTHADHRVWQDVYRPSTAVGRI
YLKLTVIDDVLVVSFKEL
Download Length: 297 bp
Antitoxin
Download Length: 134 a.a. Molecular weight: 14447.68 Da Isoelectric Point: 7.0843
>AT269235 WP_089389665.1 NZ_CP116775:495066-495467 [Pseudomonas sp. 273]
MKCPLCGGAELLHETRDLPYAYKGESTLITAVRGEFCPACGEAVLDADESARVSAQMLAFNKRVNASMVDPGFIAAVRKK
LALDQREAAEIFGGGVNAFSRYENGKTRPPLALVKLLKVLDRHPELLEEVRSG
MKCPLCGGAELLHETRDLPYAYKGESTLITAVRGEFCPACGEAVLDADESARVSAQMLAFNKRVNASMVDPGFIAAVRKK
LALDQREAAEIFGGGVNAFSRYENGKTRPPLALVKLLKVLDRHPELLEEVRSG
Download Length: 402 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|