Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yefM-yoeB (relBE)/Txe-RelB |
Location | 470415..470929 | Replicon | chromosome |
Accession | NZ_CP116755 | ||
Organism | Limosilactobacillus fermentum strain MWLf-4 |
Toxin (Protein)
Gene name | yoeB | Uniprot ID | A0A806T892 |
Locus tag | MWLf4_RS02280 | Protein ID | WP_021350110.1 |
Coordinates | 470666..470929 (+) | Length | 88 a.a. |
Antitoxin (Protein)
Gene name | yefM | Uniprot ID | C0WV67 |
Locus tag | MWLf4_RS02275 | Protein ID | WP_003684069.1 |
Coordinates | 470415..470669 (+) | Length | 85 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MWLf4_RS02260 (MWLf4_0466) | 466787..468139 | + | 1353 | WP_003684067.1 | IS4 family transposase | - |
MWLf4_RS02265 (MWLf4_0467) | 468702..469610 | - | 909 | WP_251951731.1 | IS3 family transposase | - |
MWLf4_RS02270 (MWLf4_0468) | 469547..470245 | - | 699 | Protein_436 | transposase | - |
MWLf4_RS02275 (MWLf4_0469) | 470415..470669 | + | 255 | WP_003684069.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
MWLf4_RS02280 (MWLf4_0470) | 470666..470929 | + | 264 | WP_021350110.1 | Txe/YoeB family addiction module toxin | Toxin |
MWLf4_RS02285 (MWLf4_0471) | 471335..472456 | - | 1122 | WP_101889008.1 | PTS sugar transporter subunit IIC | - |
MWLf4_RS02290 (MWLf4_0472) | 472882..474279 | - | 1398 | WP_187703846.1 | Na+/H+ antiporter NhaC | - |
MWLf4_RS02295 (MWLf4_0473) | 474667..475449 | - | 783 | WP_021350113.1 | arginine deiminase-related protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 438283..472456 | 34173 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 88 a.a. Molecular weight: 10262.99 Da Isoelectric Point: 10.7050
>T269225 WP_021350110.1 NZ_CP116755:470666-470929 [Limosilactobacillus fermentum]
MSYAIKLKRSANKDLKKIKGSYLEKSFLQIIEQLRKDPLAPNQGFEKLVPPIKGFYSRRINIQHRLVYKVDQDTQTVIIY
SAWSHNR
MSYAIKLKRSANKDLKKIKGSYLEKSFLQIIEQLRKDPLAPNQGFEKLVPPIKGFYSRRINIQHRLVYKVDQDTQTVIIY
SAWSHNR
Download Length: 264 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A806T892 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A806T868 |