Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 204677..205313 | Replicon | chromosome |
Accession | NZ_CP116736 | ||
Organism | Agrobacterium pusense strain CFBP5496 |
Toxin (Protein)
Gene name | graT | Uniprot ID | - |
Locus tag | CFBP5496_RS16155 | Protein ID | WP_045533913.1 |
Coordinates | 205032..205313 (-) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | graA | Uniprot ID | - |
Locus tag | CFBP5496_RS16150 | Protein ID | WP_112766393.1 |
Coordinates | 204677..204976 (-) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CFBP5496_RS16125 (CFBP5496_0016125) | 199866..200594 | - | 729 | WP_136883442.1 | ABC transporter ATP-binding protein | - |
CFBP5496_RS16130 (CFBP5496_0016130) | 200591..201499 | - | 909 | WP_136883441.1 | branched-chain amino acid ABC transporter permease | - |
CFBP5496_RS16135 (CFBP5496_0016135) | 201496..202368 | - | 873 | WP_112637286.1 | branched-chain amino acid ABC transporter permease | - |
CFBP5496_RS16140 (CFBP5496_0016140) | 202438..203652 | - | 1215 | WP_136883440.1 | amino acid ABC transporter substrate-binding protein | - |
CFBP5496_RS16145 (CFBP5496_0016145) | 203785..204657 | + | 873 | WP_136883439.1 | AraC family transcriptional regulator | - |
CFBP5496_RS16150 (CFBP5496_0016150) | 204677..204976 | - | 300 | WP_112766393.1 | HigA family addiction module antitoxin | Antitoxin |
CFBP5496_RS16155 (CFBP5496_0016155) | 205032..205313 | - | 282 | WP_045533913.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
CFBP5496_RS16160 (CFBP5496_0016160) | 205375..206196 | - | 822 | WP_136883438.1 | ABC transporter ATP-binding protein | - |
CFBP5496_RS16165 (CFBP5496_0016165) | 206193..207227 | - | 1035 | WP_136883437.1 | iron chelate uptake ABC transporter family permease subunit | - |
CFBP5496_RS16170 (CFBP5496_0016170) | 207230..208273 | - | 1044 | WP_136883436.1 | iron ABC transporter permease | - |
CFBP5496_RS16175 (CFBP5496_0016175) | 208270..209277 | - | 1008 | WP_136883435.1 | iron-siderophore ABC transporter substrate-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | katB | 193929..265869 | 71940 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10610.04 Da Isoelectric Point: 9.0298
>T269223 WP_045533913.1 NZ_CP116736:c205313-205032 [Agrobacterium pusense]
MIRSFKNKLTASIDDGSVKKGFPSDMLRRAQQLLTVLDAATTVEDLRSPPGNRLEKLSGDREGQYSIRINKQWRICFVWT
QAGPENVEITDYH
MIRSFKNKLTASIDDGSVKKGFPSDMLRRAQQLLTVLDAATTVEDLRSPPGNRLEKLSGDREGQYSIRINKQWRICFVWT
QAGPENVEITDYH
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|