Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
Location | 6000793..6001388 | Replicon | chromosome |
Accession | NZ_CP116725 | ||
Organism | Pseudomonas aeruginosa strain 2881 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A241XLJ5 |
Locus tag | PMJ88_RS28430 | Protein ID | WP_003117425.1 |
Coordinates | 6001110..6001388 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | PMJ88_RS28425 | Protein ID | WP_003099268.1 |
Coordinates | 6000793..6001098 (-) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PMJ88_RS28395 (PMJ88_28395) | 5997436..5997711 | - | 276 | WP_033896065.1 | mercury resistance system periplasmic binding protein MerP | - |
PMJ88_RS28400 (PMJ88_28400) | 5997727..5998077 | - | 351 | WP_001294660.1 | mercuric transport protein MerT | - |
PMJ88_RS28405 (PMJ88_28405) | 5998149..5998604 | + | 456 | WP_033896066.1 | Hg(II)-responsive transcriptional regulator | - |
PMJ88_RS28410 (PMJ88_28410) | 5998966..5999880 | - | 915 | WP_227495466.1 | hypothetical protein | - |
PMJ88_RS28415 (PMJ88_28415) | 5999919..6000131 | - | 213 | WP_025297679.1 | AlpA family phage regulatory protein | - |
PMJ88_RS28425 (PMJ88_28425) | 6000793..6001098 | - | 306 | WP_003099268.1 | HigA family addiction module antitoxin | Antitoxin |
PMJ88_RS28430 (PMJ88_28430) | 6001110..6001388 | - | 279 | WP_003117425.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PMJ88_RS28435 (PMJ88_28435) | 6001441..6001565 | - | 125 | Protein_5625 | integrase | - |
PMJ88_RS28440 (PMJ88_28440) | 6001713..6003941 | + | 2229 | WP_003113525.1 | TonB-dependent receptor | - |
PMJ88_RS28445 (PMJ88_28445) | 6004011..6004658 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
PMJ88_RS28450 (PMJ88_28450) | 6004720..6005958 | - | 1239 | WP_014603324.1 | C69 family dipeptidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10701.28 Da Isoelectric Point: 8.5576
>T269210 WP_003117425.1 NZ_CP116725:c6001388-6001110 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAARELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAARELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|