Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
Location | 6051434..6052029 | Replicon | chromosome |
Accession | NZ_CP116724 | ||
Organism | Pseudomonas aeruginosa strain 2880 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A241XLJ5 |
Locus tag | PMJ92_RS28715 | Protein ID | WP_003117425.1 |
Coordinates | 6051751..6052029 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | PMJ92_RS28710 | Protein ID | WP_003099268.1 |
Coordinates | 6051434..6051739 (-) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PMJ92_RS28675 (PMJ92_28675) | 6046657..6046908 | - | 252 | WP_003115979.1 | hypothetical protein | - |
PMJ92_RS28680 (PMJ92_28680) | 6047030..6047464 | - | 435 | WP_023087663.1 | hypothetical protein | - |
PMJ92_RS28685 (PMJ92_28685) | 6047980..6048270 | - | 291 | WP_033896069.1 | DUF5447 family protein | - |
PMJ92_RS28690 (PMJ92_28690) | 6048446..6048718 | - | 273 | WP_004352675.1 | hypothetical protein | - |
PMJ92_RS28695 (PMJ92_28695) | 6049165..6049500 | + | 336 | WP_025297674.1 | hypothetical protein | - |
PMJ92_RS28700 (PMJ92_28700) | 6049553..6050644 | + | 1092 | WP_124135598.1 | hypothetical protein | - |
PMJ92_RS28705 (PMJ92_28705) | 6050705..6051097 | - | 393 | WP_025297673.1 | hypothetical protein | - |
PMJ92_RS28710 (PMJ92_28710) | 6051434..6051739 | - | 306 | WP_003099268.1 | HigA family addiction module antitoxin | Antitoxin |
PMJ92_RS28715 (PMJ92_28715) | 6051751..6052029 | - | 279 | WP_003117425.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PMJ92_RS28720 (PMJ92_28720) | 6052354..6054582 | + | 2229 | WP_003113525.1 | TonB-dependent receptor | - |
PMJ92_RS28725 (PMJ92_28725) | 6054652..6055299 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
PMJ92_RS28730 (PMJ92_28730) | 6055361..6056599 | - | 1239 | WP_014603324.1 | C69 family dipeptidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10701.28 Da Isoelectric Point: 8.5576
>T269201 WP_003117425.1 NZ_CP116724:c6052029-6051751 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAARELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAARELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|