Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
| Location | 6170849..6171444 | Replicon | chromosome |
| Accession | NZ_CP116722 | ||
| Organism | Pseudomonas aeruginosa strain 2868 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A241XLJ5 |
| Locus tag | PMJ90_RS29460 | Protein ID | WP_003117425.1 |
| Coordinates | 6171166..6171444 (-) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PMJ90_RS29455 | Protein ID | WP_003099268.1 |
| Coordinates | 6170849..6171154 (-) | Length | 102 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PMJ90_RS29420 (PMJ90_29420) | 6166072..6166323 | - | 252 | WP_003115979.1 | hypothetical protein | - |
| PMJ90_RS29425 (PMJ90_29425) | 6166445..6166879 | - | 435 | WP_023087663.1 | hypothetical protein | - |
| PMJ90_RS29430 (PMJ90_29430) | 6167395..6167685 | - | 291 | WP_033896069.1 | DUF5447 family protein | - |
| PMJ90_RS29435 (PMJ90_29435) | 6167861..6168133 | - | 273 | WP_004352675.1 | hypothetical protein | - |
| PMJ90_RS29440 (PMJ90_29440) | 6168580..6168915 | + | 336 | WP_025297674.1 | hypothetical protein | - |
| PMJ90_RS29445 (PMJ90_29445) | 6168968..6170059 | + | 1092 | WP_124135598.1 | hypothetical protein | - |
| PMJ90_RS29450 (PMJ90_29450) | 6170120..6170512 | - | 393 | WP_025297673.1 | hypothetical protein | - |
| PMJ90_RS29455 (PMJ90_29455) | 6170849..6171154 | - | 306 | WP_003099268.1 | HigA family addiction module antitoxin | Antitoxin |
| PMJ90_RS29460 (PMJ90_29460) | 6171166..6171444 | - | 279 | WP_003117425.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PMJ90_RS29465 (PMJ90_29465) | 6171769..6173997 | + | 2229 | WP_003113525.1 | TonB-dependent receptor | - |
| PMJ90_RS29470 (PMJ90_29470) | 6174067..6174714 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
| PMJ90_RS29475 (PMJ90_29475) | 6174776..6176014 | - | 1239 | WP_014603324.1 | C69 family dipeptidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10701.28 Da Isoelectric Point: 8.5576
>T269193 WP_003117425.1 NZ_CP116722:c6171444-6171166 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAARELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAARELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|