Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
Location | 6023119..6023714 | Replicon | chromosome |
Accession | NZ_CP116721 | ||
Organism | Pseudomonas aeruginosa strain 2867 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A241XLJ5 |
Locus tag | PMJ93_RS28460 | Protein ID | WP_003117425.1 |
Coordinates | 6023436..6023714 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | PMJ93_RS28455 | Protein ID | WP_003099268.1 |
Coordinates | 6023119..6023424 (-) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PMJ93_RS28420 (PMJ93_28420) | 6018342..6018593 | - | 252 | WP_003115979.1 | hypothetical protein | - |
PMJ93_RS28425 (PMJ93_28425) | 6018715..6019149 | - | 435 | WP_023087663.1 | hypothetical protein | - |
PMJ93_RS28430 (PMJ93_28430) | 6019665..6019955 | - | 291 | WP_033896069.1 | DUF5447 family protein | - |
PMJ93_RS28435 (PMJ93_28435) | 6020131..6020403 | - | 273 | WP_004352675.1 | hypothetical protein | - |
PMJ93_RS28440 (PMJ93_28440) | 6020850..6021185 | + | 336 | WP_025297674.1 | hypothetical protein | - |
PMJ93_RS28445 (PMJ93_28445) | 6021238..6022329 | + | 1092 | WP_124135598.1 | hypothetical protein | - |
PMJ93_RS28450 (PMJ93_28450) | 6022390..6022782 | - | 393 | WP_025297673.1 | hypothetical protein | - |
PMJ93_RS28455 (PMJ93_28455) | 6023119..6023424 | - | 306 | WP_003099268.1 | HigA family addiction module antitoxin | Antitoxin |
PMJ93_RS28460 (PMJ93_28460) | 6023436..6023714 | - | 279 | WP_003117425.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PMJ93_RS28465 (PMJ93_28465) | 6024039..6026267 | + | 2229 | WP_003113525.1 | TonB-dependent receptor | - |
PMJ93_RS28470 (PMJ93_28470) | 6026337..6026984 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
PMJ93_RS28475 (PMJ93_28475) | 6027046..6028284 | - | 1239 | WP_014603324.1 | C69 family dipeptidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10701.28 Da Isoelectric Point: 8.5576
>T269186 WP_003117425.1 NZ_CP116721:c6023714-6023436 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAARELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAARELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|