Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
Location | 5987138..5987733 | Replicon | chromosome |
Accession | NZ_CP116720 | ||
Organism | Pseudomonas aeruginosa strain 2866 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A241XLJ5 |
Locus tag | PMJ84_RS28390 | Protein ID | WP_003117425.1 |
Coordinates | 5987455..5987733 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | PMJ84_RS28385 | Protein ID | WP_003099268.1 |
Coordinates | 5987138..5987443 (-) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PMJ84_RS28350 (PMJ84_28350) | 5982361..5982612 | - | 252 | WP_003115979.1 | hypothetical protein | - |
PMJ84_RS28355 (PMJ84_28355) | 5982734..5983168 | - | 435 | WP_023087663.1 | hypothetical protein | - |
PMJ84_RS28360 (PMJ84_28360) | 5983684..5983974 | - | 291 | WP_033896069.1 | DUF5447 family protein | - |
PMJ84_RS28365 (PMJ84_28365) | 5984150..5984422 | - | 273 | WP_004352675.1 | hypothetical protein | - |
PMJ84_RS28370 (PMJ84_28370) | 5984869..5985204 | + | 336 | WP_025297674.1 | hypothetical protein | - |
PMJ84_RS28375 (PMJ84_28375) | 5985257..5986348 | + | 1092 | WP_124135598.1 | hypothetical protein | - |
PMJ84_RS28380 (PMJ84_28380) | 5986409..5986801 | - | 393 | WP_025297673.1 | hypothetical protein | - |
PMJ84_RS28385 (PMJ84_28385) | 5987138..5987443 | - | 306 | WP_003099268.1 | HigA family addiction module antitoxin | Antitoxin |
PMJ84_RS28390 (PMJ84_28390) | 5987455..5987733 | - | 279 | WP_003117425.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PMJ84_RS28395 (PMJ84_28395) | 5988058..5990286 | + | 2229 | WP_003113525.1 | TonB-dependent receptor | - |
PMJ84_RS28400 (PMJ84_28400) | 5990356..5991003 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
PMJ84_RS28405 (PMJ84_28405) | 5991065..5992303 | - | 1239 | WP_014603324.1 | C69 family dipeptidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10701.28 Da Isoelectric Point: 8.5576
>T269178 WP_003117425.1 NZ_CP116720:c5987733-5987455 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAARELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAARELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|