Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
Location | 5908014..5908609 | Replicon | chromosome |
Accession | NZ_CP116718 | ||
Organism | Pseudomonas aeruginosa strain 2858 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A241XLJ5 |
Locus tag | PMJ85_RS27905 | Protein ID | WP_003117425.1 |
Coordinates | 5908331..5908609 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | PMJ85_RS27900 | Protein ID | WP_003099268.1 |
Coordinates | 5908014..5908319 (-) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PMJ85_RS27865 (PMJ85_27865) | 5903237..5903488 | - | 252 | WP_003115979.1 | hypothetical protein | - |
PMJ85_RS27870 (PMJ85_27870) | 5903610..5904044 | - | 435 | WP_023087663.1 | hypothetical protein | - |
PMJ85_RS27875 (PMJ85_27875) | 5904560..5904850 | - | 291 | WP_033896069.1 | DUF5447 family protein | - |
PMJ85_RS27880 (PMJ85_27880) | 5905026..5905298 | - | 273 | WP_004352675.1 | hypothetical protein | - |
PMJ85_RS27885 (PMJ85_27885) | 5905745..5906080 | + | 336 | WP_025297674.1 | hypothetical protein | - |
PMJ85_RS27890 (PMJ85_27890) | 5906133..5907224 | + | 1092 | WP_124135598.1 | hypothetical protein | - |
PMJ85_RS27895 (PMJ85_27895) | 5907285..5907677 | - | 393 | WP_025297673.1 | hypothetical protein | - |
PMJ85_RS27900 (PMJ85_27900) | 5908014..5908319 | - | 306 | WP_003099268.1 | HigA family addiction module antitoxin | Antitoxin |
PMJ85_RS27905 (PMJ85_27905) | 5908331..5908609 | - | 279 | WP_003117425.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PMJ85_RS27910 (PMJ85_27910) | 5908934..5911162 | + | 2229 | WP_003113525.1 | TonB-dependent receptor | - |
PMJ85_RS27915 (PMJ85_27915) | 5911232..5911879 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
PMJ85_RS27920 (PMJ85_27920) | 5911941..5913179 | - | 1239 | WP_014603324.1 | C69 family dipeptidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10701.28 Da Isoelectric Point: 8.5576
>T269170 WP_003117425.1 NZ_CP116718:c5908609-5908331 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAARELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAARELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|