Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
| Location | 6069321..6069916 | Replicon | chromosome |
| Accession | NZ_CP116717 | ||
| Organism | Pseudomonas aeruginosa strain 2857 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A241XLJ5 |
| Locus tag | PMJ94_RS28810 | Protein ID | WP_003117425.1 |
| Coordinates | 6069638..6069916 (-) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PMJ94_RS28805 | Protein ID | WP_003099268.1 |
| Coordinates | 6069321..6069626 (-) | Length | 102 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PMJ94_RS28775 (PMJ94_28775) | 6065964..6066239 | - | 276 | WP_033896065.1 | mercury resistance system periplasmic binding protein MerP | - |
| PMJ94_RS28780 (PMJ94_28780) | 6066255..6066605 | - | 351 | WP_001294660.1 | mercuric transport protein MerT | - |
| PMJ94_RS28785 (PMJ94_28785) | 6066677..6067132 | + | 456 | WP_033896066.1 | Hg(II)-responsive transcriptional regulator | - |
| PMJ94_RS28790 (PMJ94_28790) | 6067494..6068408 | - | 915 | WP_227495466.1 | hypothetical protein | - |
| PMJ94_RS28795 (PMJ94_28795) | 6068447..6068659 | - | 213 | WP_025297679.1 | AlpA family phage regulatory protein | - |
| PMJ94_RS28805 (PMJ94_28805) | 6069321..6069626 | - | 306 | WP_003099268.1 | HigA family addiction module antitoxin | Antitoxin |
| PMJ94_RS28810 (PMJ94_28810) | 6069638..6069916 | - | 279 | WP_003117425.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PMJ94_RS28815 (PMJ94_28815) | 6069969..6070093 | - | 125 | Protein_5700 | integrase | - |
| PMJ94_RS28820 (PMJ94_28820) | 6070241..6072469 | + | 2229 | WP_272225935.1 | TonB-dependent receptor | - |
| PMJ94_RS28825 (PMJ94_28825) | 6072539..6073186 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
| PMJ94_RS28830 (PMJ94_28830) | 6073248..6074486 | - | 1239 | WP_014603324.1 | C69 family dipeptidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10701.28 Da Isoelectric Point: 8.5576
>T269162 WP_003117425.1 NZ_CP116717:c6069916-6069638 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAARELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAARELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|