Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
Location | 5979559..5980154 | Replicon | chromosome |
Accession | NZ_CP116715 | ||
Organism | Pseudomonas aeruginosa strain 2856 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A241XLJ5 |
Locus tag | PMJ91_RS28590 | Protein ID | WP_003117425.1 |
Coordinates | 5979876..5980154 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | PMJ91_RS28585 | Protein ID | WP_003099268.1 |
Coordinates | 5979559..5979864 (-) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PMJ91_RS28555 (PMJ91_28555) | 5976202..5976477 | - | 276 | WP_033896065.1 | mercury resistance system periplasmic binding protein MerP | - |
PMJ91_RS28560 (PMJ91_28560) | 5976493..5976843 | - | 351 | WP_001294660.1 | mercuric transport protein MerT | - |
PMJ91_RS28565 (PMJ91_28565) | 5976915..5977370 | + | 456 | WP_033896066.1 | Hg(II)-responsive transcriptional regulator | - |
PMJ91_RS28570 (PMJ91_28570) | 5977732..5978646 | - | 915 | WP_227495466.1 | hypothetical protein | - |
PMJ91_RS28575 (PMJ91_28575) | 5978685..5978897 | - | 213 | WP_025297679.1 | AlpA family phage regulatory protein | - |
PMJ91_RS28585 (PMJ91_28585) | 5979559..5979864 | - | 306 | WP_003099268.1 | HigA family addiction module antitoxin | Antitoxin |
PMJ91_RS28590 (PMJ91_28590) | 5979876..5980154 | - | 279 | WP_003117425.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PMJ91_RS28595 (PMJ91_28595) | 5980207..5980331 | - | 125 | Protein_5655 | integrase | - |
PMJ91_RS28600 (PMJ91_28600) | 5980479..5982707 | + | 2229 | WP_003113525.1 | TonB-dependent receptor | - |
PMJ91_RS28605 (PMJ91_28605) | 5982777..5983424 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
PMJ91_RS28610 (PMJ91_28610) | 5983486..5984724 | - | 1239 | WP_014603324.1 | C69 family dipeptidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10701.28 Da Isoelectric Point: 8.5576
>T269155 WP_003117425.1 NZ_CP116715:c5980154-5979876 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAARELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAARELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|