Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yefM-yoeB (relBE)/Txe-YefM |
| Location | 1758084..1758604 | Replicon | chromosome |
| Accession | NZ_CP116692 | ||
| Organism | Agrobacterium tumefaciens strain A74a | ||
Toxin (Protein)
| Gene name | yoeB | Uniprot ID | - |
| Locus tag | G6M15_RS08885 | Protein ID | WP_174008824.1 |
| Coordinates | 1758084..1758353 (-) | Length | 90 a.a. |
Antitoxin (Protein)
| Gene name | yefM | Uniprot ID | - |
| Locus tag | G6M15_RS08890 | Protein ID | WP_174008825.1 |
| Coordinates | 1758350..1758604 (-) | Length | 85 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| G6M15_RS08865 (G6M15_08865) | 1753113..1754807 | - | 1695 | WP_174008820.1 | iron ABC transporter permease | - |
| G6M15_RS08870 (G6M15_08870) | 1754817..1755800 | - | 984 | WP_174008821.1 | ABC transporter substrate-binding protein | - |
| G6M15_RS08875 (G6M15_08875) | 1756111..1757355 | - | 1245 | WP_174008822.1 | PLP-dependent aminotransferase family protein | - |
| G6M15_RS08880 (G6M15_08880) | 1757630..1758079 | + | 450 | WP_174008823.1 | RbsD/FucU family protein | - |
| G6M15_RS08885 (G6M15_08885) | 1758084..1758353 | - | 270 | WP_174008824.1 | Txe/YoeB family addiction module toxin | Toxin |
| G6M15_RS08890 (G6M15_08890) | 1758350..1758604 | - | 255 | WP_174008825.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
| G6M15_RS08895 (G6M15_08895) | 1758743..1759762 | - | 1020 | WP_174008826.1 | ketol-acid reductoisomerase | - |
| G6M15_RS08900 (G6M15_08900) | 1759807..1760460 | - | 654 | WP_003513063.1 | TetR/AcrR family transcriptional regulator | - |
| G6M15_RS08905 (G6M15_08905) | 1760857..1761762 | - | 906 | WP_174008827.1 | AraC family transcriptional regulator | - |
| G6M15_RS08910 (G6M15_08910) | 1761952..1762998 | + | 1047 | WP_174008828.1 | NAD(P)-dependent alcohol dehydrogenase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 90 a.a. Molecular weight: 10626.12 Da Isoelectric Point: 9.8742
>T269131 WP_174008824.1 NZ_CP116692:c1758353-1758084 [Agrobacterium tumefaciens]
MKLVWTLSSWDDYEFWQRTDARMVEKINDLIRNAKRTPFAGLGKPEPLKGDMAGYWSRRITAEHRFVYRVSGSGSEQRLE
IIQCRFHYQ
MKLVWTLSSWDDYEFWQRTDARMVEKINDLIRNAKRTPFAGLGKPEPLKGDMAGYWSRRITAEHRFVYRVSGSGSEQRLE
IIQCRFHYQ
Download Length: 270 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|