Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yefM-yoeB (relBE)/YoeB-RelB |
Location | 2055431..2056018 | Replicon | chromosome |
Accession | NZ_CP116683 | ||
Organism | Agrobacterium fabrum strain 2788 |
Toxin (Protein)
Gene name | yoeB | Uniprot ID | - |
Locus tag | G6L39_RS10185 | Protein ID | WP_080807502.1 |
Coordinates | 2055431..2055715 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | yefM | Uniprot ID | - |
Locus tag | G6L39_RS10190 | Protein ID | WP_080807499.1 |
Coordinates | 2055767..2056018 (-) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
G6L39_RS10160 (G6L39_010160) | 2050910..2051524 | - | 615 | WP_244520223.1 | hypothetical protein | - |
G6L39_RS10165 (G6L39_010165) | 2051711..2052844 | + | 1134 | WP_167305544.1 | alpha-hydroxy acid oxidase | - |
G6L39_RS10170 (G6L39_010170) | 2053041..2053385 | - | 345 | WP_006311727.1 | multidrug efflux SMR transporter | - |
G6L39_RS10175 (G6L39_010175) | 2053382..2053966 | - | 585 | WP_010972227.1 | TetR/AcrR family transcriptional regulator | - |
G6L39_RS10180 (G6L39_010180) | 2054156..2055427 | + | 1272 | WP_167305628.1 | D-alanyl-D-alanine carboxypeptidase | - |
G6L39_RS10185 (G6L39_010185) | 2055431..2055715 | - | 285 | WP_080807502.1 | Txe/YoeB family addiction module toxin | Toxin |
G6L39_RS10190 (G6L39_010190) | 2055767..2056018 | - | 252 | WP_080807499.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
G6L39_RS10195 (G6L39_010195) | 2056071..2056820 | - | 750 | WP_080807496.1 | metallophosphoesterase family protein | - |
G6L39_RS10200 (G6L39_010200) | 2056826..2057182 | - | 357 | WP_006311723.1 | hydroxyisourate hydrolase | - |
G6L39_RS10205 (G6L39_010205) | 2057179..2057679 | - | 501 | WP_173992757.1 | ureidoglycolate lyase | - |
G6L39_RS10210 (G6L39_010210) | 2057683..2058045 | - | 363 | WP_010972232.1 | DUF86 domain-containing protein | - |
G6L39_RS10215 (G6L39_010215) | 2058042..2058335 | - | 294 | WP_010972233.1 | nucleotidyltransferase family protein | - |
G6L39_RS10220 (G6L39_010220) | 2058389..2058886 | - | 498 | WP_080807490.1 | 2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase | - |
G6L39_RS10225 (G6L39_010225) | 2058886..2059809 | - | 924 | WP_080807485.1 | allantoinase PuuE | - |
G6L39_RS10230 (G6L39_010230) | 2060011..2060718 | - | 708 | WP_080807479.1 | DUF1045 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11487.22 Da Isoelectric Point: 9.5189
>T269122 WP_080807502.1 NZ_CP116683:c2055715-2055431 [Agrobacterium fabrum]
MQQKGTIALGWSHEGWEDYLHWQKYDRKMLERINELIKDCRRHPFEGIGKPEPLRFQLKGLWSRRISQEHRLVYELRGDG
EKAVLIIHQCRFHY
MQQKGTIALGWSHEGWEDYLHWQKYDRKMLERINELIKDCRRHPFEGIGKPEPLRFQLKGLWSRRISQEHRLVYELRGDG
EKAVLIIHQCRFHY
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|