Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
| Location | 5759236..5759831 | Replicon | chromosome |
| Accession | NZ_CP116682 | ||
| Organism | Pseudomonas aeruginosa strain HS337 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | V6ALY3 |
| Locus tag | OK431_RS27505 | Protein ID | WP_003113526.1 |
| Coordinates | 5759553..5759831 (-) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | OK431_RS27500 | Protein ID | WP_003113527.1 |
| Coordinates | 5759236..5759541 (-) | Length | 102 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OK431_RS27480 (OK431_27465) | 5755312..5755569 | + | 258 | WP_010793759.1 | ATP-binding protein | - |
| OK431_RS27485 (OK431_27470) | 5755945..5756808 | - | 864 | WP_010793758.1 | integrase domain-containing protein | - |
| OK431_RS27490 (OK431_27475) | 5757410..5758552 | - | 1143 | WP_010793757.1 | STY4528 family pathogenicity island replication protein | - |
| OK431_RS27500 (OK431_27485) | 5759236..5759541 | - | 306 | WP_003113527.1 | HigA family addiction module antitoxin | Antitoxin |
| OK431_RS27505 (OK431_27490) | 5759553..5759831 | - | 279 | WP_003113526.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| OK431_RS27510 (OK431_27495) | 5759884..5760012 | - | 129 | Protein_5438 | integrase | - |
| OK431_RS27515 (OK431_27500) | 5760160..5762388 | + | 2229 | WP_003099265.1 | TonB-dependent receptor | - |
| OK431_RS27520 (OK431_27505) | 5762458..5763105 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
| OK431_RS27525 (OK431_27510) | 5763167..5764405 | - | 1239 | WP_010793756.1 | C69 family dipeptidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10646.19 Da Isoelectric Point: 7.8937
>T269118 WP_003113526.1 NZ_CP116682:c5759831-5759553 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|