Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 5140103..5140692 | Replicon | chromosome |
| Accession | NZ_CP116672 | ||
| Organism | Xanthomonas hortorum pv. pelargonii strain 305 | ||
Toxin (Protein)
| Gene name | graT | Uniprot ID | - |
| Locus tag | PML25_RS21685 | Protein ID | WP_168959041.1 |
| Coordinates | 5140411..5140692 (-) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PML25_RS21680 | Protein ID | WP_168959042.1 |
| Coordinates | 5140103..5140393 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PML25_RS21650 (PML25_21650) | 5135277..5135609 | + | 333 | WP_168959046.1 | hypothetical protein | - |
| PML25_RS21655 (PML25_21655) | 5135724..5136878 | - | 1155 | WP_233366566.1 | hypothetical protein | - |
| PML25_RS21660 (PML25_21660) | 5136913..5137320 | - | 408 | WP_168959045.1 | hypothetical protein | - |
| PML25_RS21665 (PML25_21665) | 5137734..5137924 | + | 191 | Protein_4234 | hypothetical protein | - |
| PML25_RS21670 (PML25_21670) | 5138200..5139018 | - | 819 | WP_218974083.1 | AraC family transcriptional regulator | - |
| PML25_RS21675 (PML25_21675) | 5139237..5139980 | + | 744 | WP_168959043.1 | SDR family oxidoreductase | - |
| PML25_RS21680 (PML25_21680) | 5140103..5140393 | - | 291 | WP_168959042.1 | HigA family addiction module antitoxin | Antitoxin |
| PML25_RS21685 (PML25_21685) | 5140411..5140692 | - | 282 | WP_168959041.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PML25_RS21690 (PML25_21690) | 5140904..5141959 | - | 1056 | WP_168959040.1 | virulence RhuM family protein | - |
| PML25_RS21695 (PML25_21695) | 5142098..5144506 | - | 2409 | WP_168959039.1 | exodeoxyribonuclease V subunit alpha | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 11056.76 Da Isoelectric Point: 9.7972
>T269096 WP_168959041.1 NZ_CP116672:c5140692-5140411 [Xanthomonas hortorum pv. pelargonii]
MIRSFVDKEAEKIWLGERSRRLPADIQPVARRKLRMLNAAAHLDDLRIPPANRLEALKGERRGQYSIRINDQWRICFRWM
EGDVAEVEIVDYH
MIRSFVDKEAEKIWLGERSRRLPADIQPVARRKLRMLNAAAHLDDLRIPPANRLEALKGERRGQYSIRINDQWRICFRWM
EGDVAEVEIVDYH
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|