Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 3572980..3573795 | Replicon | chromosome |
| Accession | NZ_CP116621 | ||
| Organism | Proteus terrae strain TP22 | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | - |
| Locus tag | ONR67_RS16535 | Protein ID | WP_075673429.1 |
| Coordinates | 3573322..3573795 (+) | Length | 158 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | - |
| Locus tag | ONR67_RS16530 | Protein ID | WP_075673430.1 |
| Coordinates | 3572980..3573315 (+) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ONR67_RS16510 (ONR67_16510) | 3568669..3570093 | + | 1425 | WP_072069056.1 | aspartate ammonia-lyase | - |
| ONR67_RS16515 (ONR67_16515) | 3570252..3571577 | + | 1326 | WP_036934359.1 | anaerobic C4-dicarboxylate transporter | - |
| ONR67_RS16520 (ONR67_16520) | 3571761..3572333 | + | 573 | WP_075673431.1 | transcriptional regulator | - |
| ONR67_RS16530 (ONR67_16530) | 3572980..3573315 | + | 336 | WP_075673430.1 | type II toxin-antitoxin system PrlF family antitoxin | Antitoxin |
| ONR67_RS16535 (ONR67_16535) | 3573322..3573795 | + | 474 | WP_075673429.1 | type II toxin-antitoxin system YhaV family toxin | Toxin |
| ONR67_RS16540 (ONR67_16540) | 3574106..3574753 | + | 648 | WP_075673428.1 | type II CAAX endopeptidase family protein | - |
| ONR67_RS16545 (ONR67_16545) | 3575056..3575691 | + | 636 | WP_075673427.1 | DUF1449 family protein | - |
| ONR67_RS16550 (ONR67_16550) | 3575778..3577973 | + | 2196 | WP_099659727.1 | flotillin family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 158 a.a. Molecular weight: 18639.26 Da Isoelectric Point: 9.2715
>T269088 WP_075673429.1 NZ_CP116621:3573322-3573795 [Proteus terrae]
MDFPTDLNGWTIYAHPCFKQQYDELLQKVEALKKKYPEDYQKKADTKIFAHVLKSIVNITNDPRAPEFRLGNTLGEENKN
WSRIKLVNGRYRLFFRFSFKEKIIILAWINDNDTLRTYGNKTDAYRVFEKKLKKGHPPKNWNDLFSDCINEADCQDP
MDFPTDLNGWTIYAHPCFKQQYDELLQKVEALKKKYPEDYQKKADTKIFAHVLKSIVNITNDPRAPEFRLGNTLGEENKN
WSRIKLVNGRYRLFFRFSFKEKIIILAWINDNDTLRTYGNKTDAYRVFEKKLKKGHPPKNWNDLFSDCINEADCQDP
Download Length: 474 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|