Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 3501228..3502043 | Replicon | chromosome |
| Accession | NZ_CP116620 | ||
| Organism | Proteus terrae strain CZP50 | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | - |
| Locus tag | ONR71_RS16195 | Protein ID | WP_075673429.1 |
| Coordinates | 3501570..3502043 (+) | Length | 158 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | - |
| Locus tag | ONR71_RS16190 | Protein ID | WP_075673430.1 |
| Coordinates | 3501228..3501563 (+) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ONR71_RS16170 (ONR71_16170) | 3496917..3498341 | + | 1425 | WP_072069056.1 | aspartate ammonia-lyase | - |
| ONR71_RS16175 (ONR71_16175) | 3498500..3499825 | + | 1326 | WP_036934359.1 | anaerobic C4-dicarboxylate transporter | - |
| ONR71_RS16180 (ONR71_16180) | 3500009..3500581 | + | 573 | WP_075673431.1 | transcriptional regulator | - |
| ONR71_RS16190 (ONR71_16190) | 3501228..3501563 | + | 336 | WP_075673430.1 | type II toxin-antitoxin system PrlF family antitoxin | Antitoxin |
| ONR71_RS16195 (ONR71_16195) | 3501570..3502043 | + | 474 | WP_075673429.1 | type II toxin-antitoxin system YhaV family toxin | Toxin |
| ONR71_RS16200 (ONR71_16200) | 3502354..3503001 | + | 648 | WP_075673428.1 | type II CAAX endopeptidase family protein | - |
| ONR71_RS16205 (ONR71_16205) | 3503304..3503939 | + | 636 | WP_156734149.1 | DUF1449 family protein | - |
| ONR71_RS16210 (ONR71_16210) | 3504026..3506221 | + | 2196 | WP_099659727.1 | flotillin family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 158 a.a. Molecular weight: 18639.26 Da Isoelectric Point: 9.2715
>T269082 WP_075673429.1 NZ_CP116620:3501570-3502043 [Proteus terrae]
MDFPTDLNGWTIYAHPCFKQQYDELLQKVEALKKKYPEDYQKKADTKIFAHVLKSIVNITNDPRAPEFRLGNTLGEENKN
WSRIKLVNGRYRLFFRFSFKEKIIILAWINDNDTLRTYGNKTDAYRVFEKKLKKGHPPKNWNDLFSDCINEADCQDP
MDFPTDLNGWTIYAHPCFKQQYDELLQKVEALKKKYPEDYQKKADTKIFAHVLKSIVNITNDPRAPEFRLGNTLGEENKN
WSRIKLVNGRYRLFFRFSFKEKIIILAWINDNDTLRTYGNKTDAYRVFEKKLKKGHPPKNWNDLFSDCINEADCQDP
Download Length: 474 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|