Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | HipBST/HipA(toxin) |
Location | 1241940..1243203 | Replicon | chromosome |
Accession | NZ_CP116612 | ||
Organism | Porphyromonas gingivalis strain A7436-C |
Toxin (Protein)
Gene name | HipT | Uniprot ID | Q7MW07 |
Locus tag | NY148_RS05325 | Protein ID | WP_010956143.1 |
Coordinates | 1241940..1242878 (-) | Length | 313 a.a. |
Antitoxin (Protein)
Gene name | HipS | Uniprot ID | Q7MW08 |
Locus tag | NY148_RS05330 | Protein ID | WP_005874041.1 |
Coordinates | 1242868..1243203 (-) | Length | 112 a.a. |
Genomic Context
Location: 1238014..1241496 (3483 bp)
Type: Others
Protein ID: WP_005874047.1
Type: Others
Protein ID: WP_005874047.1
Location: 1241550..1241870 (321 bp)
Type: Others
Protein ID: WP_043876418.1
Type: Others
Protein ID: WP_043876418.1
Location: 1241940..1242878 (939 bp)
Type: Toxin
Protein ID: WP_010956143.1
Type: Toxin
Protein ID: WP_010956143.1
Location: 1242868..1243203 (336 bp)
Type: Antitoxin
Protein ID: WP_005874041.1
Type: Antitoxin
Protein ID: WP_005874041.1
Location: 1243200..1243424 (225 bp)
Type: Others
Protein ID: WP_005874043.1
Type: Others
Protein ID: WP_005874043.1
Location: 1243648..1244553 (906 bp)
Type: Others
Protein ID: WP_005874039.1
Type: Others
Protein ID: WP_005874039.1
Location: 1245055..1245837 (783 bp)
Type: Others
Protein ID: WP_004584112.1
Type: Others
Protein ID: WP_004584112.1
Location: 1245874..1246359 (486 bp)
Type: Others
Protein ID: WP_005874045.1
Type: Others
Protein ID: WP_005874045.1
Location: 1246594..1246764 (171 bp)
Type: Others
Protein ID: WP_080502141.1
Type: Others
Protein ID: WP_080502141.1
Location: 1246789..1247870 (1082 bp)
Type: Others
Protein ID: Protein_1036
Type: Others
Protein ID: Protein_1036
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NY148_RS05315 (NY148_05315) | 1238014..1241496 | - | 3483 | WP_005874047.1 | helicase-related protein | - |
NY148_RS05320 (NY148_05320) | 1241550..1241870 | - | 321 | WP_043876418.1 | helix-turn-helix transcriptional regulator | - |
NY148_RS05325 (NY148_05325) | 1241940..1242878 | - | 939 | WP_010956143.1 | HipA domain-containing protein | Toxin |
NY148_RS05330 (NY148_05330) | 1242868..1243203 | - | 336 | WP_005874041.1 | HipA N-terminal domain-containing protein | Antitoxin |
NY148_RS05335 (NY148_05335) | 1243200..1243424 | - | 225 | WP_005874043.1 | helix-turn-helix transcriptional regulator | - |
NY148_RS05340 (NY148_05340) | 1243648..1244553 | - | 906 | WP_005874039.1 | hypothetical protein | - |
NY148_RS05345 (NY148_05345) | 1245055..1245837 | - | 783 | WP_004584112.1 | DUF4393 domain-containing protein | - |
NY148_RS05350 (NY148_05350) | 1245874..1246359 | - | 486 | WP_005874045.1 | HU family DNA-binding protein | - |
NY148_RS05355 (NY148_05355) | 1246594..1246764 | - | 171 | WP_080502141.1 | DNA methylase | - |
NY148_RS05360 (NY148_05360) | 1246789..1247870 | - | 1082 | Protein_1036 | IS5 family transposase | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 313 a.a. Molecular weight: 36101.60 Da Isoelectric Point: 6.1022
>T269076 WP_010956143.1 NZ_CP116612:c1242878-1241940 [Porphyromonas gingivalis]
MTNRCLYCYEPLVDGEMDYHAKCCRKLFGTPQAPILPYTSSEVRALADEVVRSQTTVTGVQPKLSLDFDQMSNSPKRFTI
VGLWGRFILKPQTERYSHLPELEDVSMHLAEIAKIETVPHGLMRFSDGELCYITRRIDRTGQGEKLPMEDMCQLSERLTE
YKYKGSHEQVAKLISKYSSVPKLDLVKYWEQVLFSWLIGNADMHLKNYSLYAPEGNEYQLTPAYDLLSTALVIPEDTEEL
ALTLCGKKRKLTRQHFLEAMTASGLDEKVCDNIFARFQHILPEWEACIRQSFLPTEMQRQYIEFILLKFSQI
MTNRCLYCYEPLVDGEMDYHAKCCRKLFGTPQAPILPYTSSEVRALADEVVRSQTTVTGVQPKLSLDFDQMSNSPKRFTI
VGLWGRFILKPQTERYSHLPELEDVSMHLAEIAKIETVPHGLMRFSDGELCYITRRIDRTGQGEKLPMEDMCQLSERLTE
YKYKGSHEQVAKLISKYSSVPKLDLVKYWEQVLFSWLIGNADMHLKNYSLYAPEGNEYQLTPAYDLLSTALVIPEDTEEL
ALTLCGKKRKLTRQHFLEAMTASGLDEKVCDNIFARFQHILPEWEACIRQSFLPTEMQRQYIEFILLKFSQI
Download Length: 939 bp