Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-ratA/- |
| Location | 2771621..2771957 | Replicon | chromosome |
| Accession | NZ_CP116575 | ||
| Organism | Enterococcus faecalis strain K205-3 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | E2Z0W4 |
| Locus tag | PML83_RS13600 | Protein ID | WP_002381035.1 |
| Coordinates | 2771621..2771764 (+) | Length | 48 a.a. |
Antitoxin (RNA)
| Gene name | ratA | ||
| Locus tag | - | ||
| Coordinates | 2771908..2771957 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PML83_RS13580 | 2767722..2768351 | - | 630 | WP_002354763.1 | lytic polysaccharide monooxygenase | - |
| PML83_RS13585 | 2769044..2770660 | + | 1617 | WP_002381036.1 | phosphatase PAP2/LCP family protein | - |
| PML83_RS13590 | 2770990..2771133 | + | 144 | WP_002392818.1 | type I toxin-antitoxin system toxin PepG1 | - |
| PML83_RS13595 | 2771252..2771392 | + | 141 | WP_073340360.1 | putative holin-like toxin | - |
| PML83_RS13600 | 2771621..2771764 | + | 144 | WP_002381035.1 | putative holin-like toxin | Toxin |
| - | 2771908..2771957 | + | 50 | - | - | Antitoxin |
| PML83_RS13605 | 2771959..2776650 | - | 4692 | WP_010783624.1 | WxL domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 48 a.a. Molecular weight: 5202.20 Da Isoelectric Point: 10.0041
>T269048 WP_002381035.1 NZ_CP116575:2771621-2771764 [Enterococcus faecalis]
MNVSTKIYERRGLLSIAEALALMISFGSFIATLIFGILEAVKENNKK
MNVSTKIYERRGLLSIAEALALMISFGSFIATLIFGILEAVKENNKK
Download Length: 144 bp
Antitoxin
Download Length: 50 bp
>AT269048 NZ_CP116575:2771908-2771957 [Enterococcus faecalis]
AATAAAAATGCCCGAGCCTTAGAAAAATAAGAGGCTCGGGCATTTTTATT
AATAAAAATGCCCGAGCCTTAGAAAAATAAGAGGCTCGGGCATTTTTATT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|