Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-ratA/- |
| Location | 2770990..2771250 | Replicon | chromosome |
| Accession | NZ_CP116575 | ||
| Organism | Enterococcus faecalis strain K205-3 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | - |
| Locus tag | PML83_RS13590 | Protein ID | WP_002392818.1 |
| Coordinates | 2770990..2771133 (+) | Length | 48 a.a. |
Antitoxin (RNA)
| Gene name | ratA | ||
| Locus tag | - | ||
| Coordinates | 2771066..2771250 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PML83_RS13570 | 2766112..2766327 | - | 216 | WP_002354768.1 | zinc ribbon domain-containing protein | - |
| PML83_RS13570 | 2766112..2766327 | - | 216 | WP_002354768.1 | zinc ribbon domain-containing protein | - |
| PML83_RS13575 | 2766466..2767458 | + | 993 | WP_002354765.1 | biotin--[acetyl-CoA-carboxylase] ligase | - |
| PML83_RS13575 | 2766466..2767458 | + | 993 | WP_002354765.1 | biotin--[acetyl-CoA-carboxylase] ligase | - |
| PML83_RS13580 | 2767722..2768351 | - | 630 | WP_002354763.1 | lytic polysaccharide monooxygenase | - |
| PML83_RS13580 | 2767722..2768351 | - | 630 | WP_002354763.1 | lytic polysaccharide monooxygenase | - |
| PML83_RS13585 | 2769044..2770660 | + | 1617 | WP_002381036.1 | phosphatase PAP2/LCP family protein | - |
| PML83_RS13585 | 2769044..2770660 | + | 1617 | WP_002381036.1 | phosphatase PAP2/LCP family protein | - |
| PML83_RS13590 | 2770990..2771133 | + | 144 | WP_002392818.1 | type I toxin-antitoxin system toxin PepG1 | Toxin |
| PML83_RS13590 | 2770990..2771133 | + | 144 | WP_002392818.1 | type I toxin-antitoxin system toxin PepG1 | Toxin |
| - | 2771066..2771250 | - | 185 | - | - | Antitoxin |
| PML83_RS13595 | 2771252..2771392 | + | 141 | WP_073340360.1 | putative holin-like toxin | - |
| PML83_RS13595 | 2771252..2771392 | + | 141 | WP_073340360.1 | putative holin-like toxin | - |
| PML83_RS13600 | 2771621..2771764 | + | 144 | WP_002381035.1 | putative holin-like toxin | - |
| PML83_RS13600 | 2771621..2771764 | + | 144 | WP_002381035.1 | putative holin-like toxin | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 48 a.a. Molecular weight: 5344.49 Da Isoelectric Point: 10.6323
>T269036 WP_002392818.1 NZ_CP116575:2770990-2771133 [Enterococcus faecalis]
MNVSTKIYERRGLLSAYETIQTILGFGMFTIALIALIVKLLKNDKKK
MNVSTKIYERRGLLSAYETIQTILGFGMFTIALIALIVKLLKNDKKK
Download Length: 144 bp
Antitoxin
Download Length: 185 bp
>AT269036 NZ_CP116575:c2771250-2771066 [Enterococcus faecalis]
TGCTACAATAGAGACGAAAAGAGAGGTATGCTCTAACATACCTCTCTAGTGTAGAGCCGTTTAAGACGGTGACCTTTTTA
GTTACAAAAAATAACCGTACTCAGTCAAAGTAGACGGTTATTTTTTCTTGTCATTTTTAAGCAATTTCACAATCAGCGCA
ATCAAAGCAATGGTAAACATACCAA
TGCTACAATAGAGACGAAAAGAGAGGTATGCTCTAACATACCTCTCTAGTGTAGAGCCGTTTAAGACGGTGACCTTTTTA
GTTACAAAAAATAACCGTACTCAGTCAAAGTAGACGGTTATTTTTTCTTGTCATTTTTAAGCAATTTCACAATCAGCGCA
ATCAAAGCAATGGTAAACATACCAA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|