Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-ratA/- |
| Location | 2668239..2668702 | Replicon | chromosome |
| Accession | NZ_CP116575 | ||
| Organism | Enterococcus faecalis strain K205-3 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | S4BYM2 |
| Locus tag | PML83_RS13125 | Protein ID | WP_002392696.1 |
| Coordinates | 2668239..2668382 (-) | Length | 48 a.a. |
Antitoxin (RNA)
| Gene name | ratA | ||
| Locus tag | - | ||
| Coordinates | 2668558..2668702 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PML83_RS13110 | 2663485..2664198 | - | 714 | WP_002381063.1 | trehalose operon repressor | - |
| PML83_RS13115 | 2664460..2667204 | + | 2745 | WP_002398920.1 | glycosyl hydrolase family 65 protein | - |
| PML83_RS13120 | 2667219..2667869 | + | 651 | WP_002354875.1 | beta-phosphoglucomutase | - |
| PML83_RS13125 | 2668239..2668382 | - | 144 | WP_002392696.1 | type I toxin-antitoxin system toxin PepG1 | Toxin |
| - | 2668558..2668702 | + | 145 | - | - | Antitoxin |
| PML83_RS13130 | 2669456..2669731 | + | 276 | WP_224805966.1 | CPBP family intramembrane metalloprotease | - |
| PML83_RS13135 | 2669785..2670756 | - | 972 | WP_002381060.1 | ribose-phosphate diphosphokinase | - |
| PML83_RS13140 | 2670931..2671368 | - | 438 | WP_002354871.1 | peptide-methionine (R)-S-oxide reductase MsrB | - |
| PML83_RS13145 | 2671501..2672055 | - | 555 | WP_002354869.1 | Maf family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 48 a.a. Molecular weight: 5297.43 Da Isoelectric Point: 10.6867
>T269033 WP_002392696.1 NZ_CP116575:c2668382-2668239 [Enterococcus faecalis]
MSVLPKFTERRGLLSAYETIQTILGFGMFTIALIALIVKLLKNDNKK
MSVLPKFTERRGLLSAYETIQTILGFGMFTIALIALIVKLLKNDNKK
Download Length: 144 bp
Antitoxin
Download Length: 145 bp
>AT269033 NZ_CP116575:2668558-2668702 [Enterococcus faecalis]
TTGTGCTATAATGAAAACGAAAAGAGAGATATGCTTCAACATACCTCTCTGATGCAGAGCCGTTTAAGACGGTGACCGAT
TTTGTTACAAAAAATAACCGTACTCAGTCAAAGTAGACGGTTATTTTTTATTGTCATTTTTAACA
TTGTGCTATAATGAAAACGAAAAGAGAGATATGCTTCAACATACCTCTCTGATGCAGAGCCGTTTAAGACGGTGACCGAT
TTTGTTACAAAAAATAACCGTACTCAGTCAAAGTAGACGGTTATTTTTTATTGTCATTTTTAACA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|