Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-ratA/- |
| Location | 633433..633561 | Replicon | chromosome |
| Accession | NZ_CP116575 | ||
| Organism | Enterococcus faecalis strain K205-3 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | - |
| Locus tag | PML83_RS03240 | Protein ID | WP_271850507.1 |
| Coordinates | 633433..633561 (+) | Length | 43 a.a. |
Antitoxin (RNA)
| Gene name | ratA | ||
| Locus tag | - | ||
| Coordinates | 633460..633538 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PML83_RS03230 | 628871..631129 | + | 2259 | WP_002381251.1 | DNA helicase PcrA | - |
| PML83_RS03235 | 631255..633285 | + | 2031 | WP_002381252.1 | NAD-dependent DNA ligase LigA | - |
| PML83_RS03240 | 633433..633561 | + | 129 | WP_271850507.1 | putative holin-like toxin | Toxin |
| - | 633460..633538 | - | 79 | - | - | Antitoxin |
| PML83_RS03245 | 633677..634981 | + | 1305 | WP_089202021.1 | ISL3 family transposase | - |
| PML83_RS03250 | 635401..635706 | + | 306 | WP_002355569.1 | Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatC | - |
| PML83_RS03255 | 635706..637175 | + | 1470 | WP_002358701.1 | Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 43 a.a. Molecular weight: 4611.61 Da Isoelectric Point: 6.0098
>T269029 WP_271850507.1 NZ_CP116575:633433-633561 [Enterococcus faecalis]
MFLSVEAALGLMIGFATLVVTIIFGILALVLDNKNRLYNLKD
MFLSVEAALGLMIGFATLVVTIIFGILALVLDNKNRLYNLKD
Download Length: 129 bp
Antitoxin
Download Length: 79 bp
>AT269029 NZ_CP116575:c633538-633460 [Enterococcus faecalis]
TATTTTTGTTGTCTAAGACAAGCGCTAAGATACCGAAGATAATGGTCACAACAAGTGTTGCAAAACCAATCATCAGTCC
TATTTTTGTTGTCTAAGACAAGCGCTAAGATACCGAAGATAATGGTCACAACAAGTGTTGCAAAACCAATCATCAGTCC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|