Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | fst-RNAII/- |
Location | 308585..308779 | Replicon | chromosome |
Accession | NZ_CP116569 | ||
Organism | Enterococcus faecalis strain K198-1 |
Toxin (Protein)
Gene name | fst | Uniprot ID | - |
Locus tag | PML91_RS01535 | Protein ID | WP_015543884.1 |
Coordinates | 308684..308779 (-) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | RNAII | ||
Locus tag | - | ||
Coordinates | 308585..308649 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PML91_RS01520 | 304197..305945 | + | 1749 | WP_033626493.1 | PTS transporter subunit EIIC | - |
PML91_RS01525 | 305936..307969 | + | 2034 | WP_016626080.1 | BglG family transcription antiterminator | - |
PML91_RS01530 | 307980..308414 | + | 435 | WP_231432906.1 | PTS sugar transporter subunit IIA | - |
- | 308585..308649 | + | 65 | - | - | Antitoxin |
PML91_RS01535 | 308684..308779 | - | 96 | WP_015543884.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
PML91_RS01540 | 309025..310797 | + | 1773 | WP_010819728.1 | PTS mannitol-specific transporter subunit IIBC | - |
PML91_RS01545 | 310812..311249 | + | 438 | WP_002355279.1 | PTS sugar transporter subunit IIA | - |
PML91_RS01550 | 311264..312418 | + | 1155 | WP_016627726.1 | mannitol-1-phosphate 5-dehydrogenase | - |
PML91_RS01555 | 312486..313601 | - | 1116 | WP_016627725.1 | FAD-dependent oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3659.47 Da Isoelectric Point: 4.6275
>T268980 WP_015543884.1 NZ_CP116569:c308779-308684 [Enterococcus faecalis]
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
Download Length: 96 bp
>T268980 NZ_CP116569:c308779-308684 [Enterococcus faecalis]
ATGTACGAGATTGTCACAAAAATTCTTGTGCCGATTTTTGTCGGGATTGTCCTGAAACTTGTAACCATTTGGTTGGAAAA
ACAGAACGAGGAATAA
ATGTACGAGATTGTCACAAAAATTCTTGTGCCGATTTTTGTCGGGATTGTCCTGAAACTTGTAACCATTTGGTTGGAAAA
ACAGAACGAGGAATAA
Antitoxin
Download Length: 65 bp
>AT268980 NZ_CP116569:308585-308649 [Enterococcus faecalis]
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGTGGTAGGGTGTCTTTTTTT
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGTGGTAGGGTGTCTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|