Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | fst-RNAII/- |
Location | 328120..328314 | Replicon | chromosome |
Accession | NZ_CP116564 | ||
Organism | Enterococcus faecalis strain K188-1 |
Toxin (Protein)
Gene name | fst | Uniprot ID | - |
Locus tag | PML72_RS01665 | Protein ID | WP_015543884.1 |
Coordinates | 328219..328314 (-) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | RNAII | ||
Locus tag | - | ||
Coordinates | 328120..328184 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PML72_RS01650 (323747) | 323747..325495 | + | 1749 | WP_161975114.1 | PTS transporter subunit EIIC | - |
PML72_RS01655 (325486) | 325486..327519 | + | 2034 | WP_002355275.1 | BglG family transcription antiterminator | - |
PML72_RS01660 (327530) | 327530..327964 | + | 435 | WP_002358391.1 | PTS sugar transporter subunit IIA | - |
- (328120) | 328120..328184 | + | 65 | NuclAT_11 | - | Antitoxin |
PML72_RS01665 (328219) | 328219..328314 | - | 96 | WP_015543884.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
PML72_RS01670 (328560) | 328560..330332 | + | 1773 | WP_002405272.1 | PTS mannitol-specific transporter subunit IIBC | - |
PML72_RS01675 (330347) | 330347..330784 | + | 438 | WP_002355279.1 | PTS sugar transporter subunit IIA | - |
PML72_RS01680 (330799) | 330799..331953 | + | 1155 | WP_010775146.1 | mannitol-1-phosphate 5-dehydrogenase | - |
PML72_RS01685 (332020) | 332020..333135 | - | 1116 | WP_010707863.1 | FAD-dependent oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3659.47 Da Isoelectric Point: 4.6275
>T268936 WP_015543884.1 NZ_CP116564:c328314-328219 [Enterococcus faecalis]
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
Download Length: 96 bp
Antitoxin
Download Length: 65 bp
>AT268936 NZ_CP116564:328120-328184 [Enterococcus faecalis]
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGTGGTAGGGTGTCTTTTTTT
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGTGGTAGGGTGTCTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|