Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-ratA/- |
| Location | 2579020..2579423 | Replicon | chromosome |
| Accession | NZ_CP116559 | ||
| Organism | Enterococcus faecalis strain K137-1a | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | - |
| Locus tag | PML94_RS12240 | Protein ID | WP_023894767.1 |
| Coordinates | 2579319..2579423 (-) | Length | 35 a.a. |
Antitoxin (RNA)
| Gene name | ratA | ||
| Locus tag | - | ||
| Coordinates | 2579020..2579152 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PML94_RS12225 (2574568) | 2574568..2575281 | - | 714 | WP_002367455.1 | trehalose operon repressor | - |
| PML94_RS12230 (2575542) | 2575542..2578286 | + | 2745 | WP_104807179.1 | glycosyl hydrolase family 65 protein | - |
| PML94_RS12235 (2578301) | 2578301..2578951 | + | 651 | WP_002375514.1 | beta-phosphoglucomutase | - |
| - (2579020) | 2579020..2579152 | + | 133 | NuclAT_12 | - | Antitoxin |
| - (2579199) | 2579199..2579386 | + | 188 | NuclAT_4 | - | - |
| PML94_RS12240 (2579319) | 2579319..2579423 | - | 105 | WP_023894767.1 | putative holin-like toxin | Toxin |
| - (2579575) | 2579575..2579720 | + | 146 | NuclAT_11 | - | - |
| - (2579575) | 2579575..2579761 | + | 187 | NuclAT_5 | - | - |
| PML94_RS12245 (2579694) | 2579694..2579846 | - | 153 | WP_002375510.1 | type I toxin-antitoxin system toxin PepG1 | - |
| PML94_RS12250 (2580071) | 2580071..2581042 | - | 972 | WP_002381060.1 | ribose-phosphate diphosphokinase | - |
| PML94_RS12255 (2581217) | 2581217..2581654 | - | 438 | WP_002354871.1 | peptide-methionine (R)-S-oxide reductase MsrB | - |
| PML94_RS12260 (2581787) | 2581787..2582341 | - | 555 | WP_002354869.1 | Maf family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3799.63 Da Isoelectric Point: 10.0079
>T268900 WP_023894767.1 NZ_CP116559:c2579423-2579319 [Enterococcus faecalis]
MSAYETIQTILGFGMFTIALIALIVKLLKNDNKK
MSAYETIQTILGFGMFTIALIALIVKLLKNDNKK
Download Length: 105 bp
Antitoxin
Download Length: 133 bp
>AT268900 NZ_CP116559:2579020-2579152 [Enterococcus faecalis]
TGAAAAGAAAGATGCTTCAACATACCTCTCTAGTGTAGAGCCGTTTGAGACGGTGACCGATTTTGTTACAAAAAATAACC
GTGCTTGATTAAAGTTGACGGTTATTTTTTATTGTCATTTTTAACAGCTTTTA
TGAAAAGAAAGATGCTTCAACATACCTCTCTAGTGTAGAGCCGTTTGAGACGGTGACCGATTTTGTTACAAAAAATAACC
GTGCTTGATTAAAGTTGACGGTTATTTTTTATTGTCATTTTTAACAGCTTTTA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|