Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | fst-RNAII/- |
Location | 312411..312605 | Replicon | chromosome |
Accession | NZ_CP116559 | ||
Organism | Enterococcus faecalis strain K137-1a |
Toxin (Protein)
Gene name | fst | Uniprot ID | - |
Locus tag | PML94_RS01540 | Protein ID | WP_015543884.1 |
Coordinates | 312510..312605 (-) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | RNAII | ||
Locus tag | - | ||
Coordinates | 312411..312475 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PML94_RS01525 (308036) | 308036..309784 | + | 1749 | WP_181033811.1 | PTS transporter subunit EIIC | - |
PML94_RS01530 (309775) | 309775..311808 | + | 2034 | WP_002383677.1 | BglG family transcription antiterminator | - |
PML94_RS01535 (311819) | 311819..312253 | + | 435 | WP_104807259.1 | PTS sugar transporter subunit IIA | - |
- (312411) | 312411..312475 | + | 65 | NuclAT_14 | - | Antitoxin |
PML94_RS01540 (312510) | 312510..312605 | - | 96 | WP_015543884.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
PML94_RS01545 (312851) | 312851..314623 | + | 1773 | WP_104807258.1 | PTS mannitol-specific transporter subunit IIBC | - |
PML94_RS01550 (314638) | 314638..315075 | + | 438 | WP_002355279.1 | PTS sugar transporter subunit IIA | - |
PML94_RS01555 (315090) | 315090..316244 | + | 1155 | WP_002355280.1 | mannitol-1-phosphate 5-dehydrogenase | - |
PML94_RS01560 (316313) | 316313..317428 | - | 1116 | WP_104807257.1 | FAD-dependent oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3659.47 Da Isoelectric Point: 4.6275
>T268896 WP_015543884.1 NZ_CP116559:c312605-312510 [Enterococcus faecalis]
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
Download Length: 96 bp
Antitoxin
Download Length: 65 bp
>AT268896 NZ_CP116559:312411-312475 [Enterococcus faecalis]
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGCAGTAGGGTGTCTTTTTTT
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGCAGTAGGGTGTCTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|