Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-ratA/- |
Location | 2583511..2583735 | Replicon | chromosome |
Accession | NZ_CP116555 | ||
Organism | Enterococcus faecalis strain K70-12a |
Toxin (Protein)
Gene name | txpA | Uniprot ID | - |
Locus tag | PML75_RS12250 | Protein ID | WP_023894767.1 |
Coordinates | 2583631..2583735 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | ratA | ||
Locus tag | - | ||
Coordinates | 2583511..2583698 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PML75_RS12235 (2578880) | 2578880..2579593 | - | 714 | WP_002367455.1 | trehalose operon repressor | - |
PML75_RS12240 (2579854) | 2579854..2582598 | + | 2745 | WP_104807179.1 | glycosyl hydrolase family 65 protein | - |
PML75_RS12245 (2582613) | 2582613..2583263 | + | 651 | WP_002375514.1 | beta-phosphoglucomutase | - |
- (2583332) | 2583332..2583464 | + | 133 | NuclAT_12 | - | - |
- (2583511) | 2583511..2583698 | + | 188 | NuclAT_4 | - | Antitoxin |
PML75_RS12250 (2583631) | 2583631..2583735 | - | 105 | WP_023894767.1 | putative holin-like toxin | Toxin |
- (2583887) | 2583887..2584032 | + | 146 | NuclAT_11 | - | - |
- (2583887) | 2583887..2584073 | + | 187 | NuclAT_5 | - | - |
PML75_RS12255 (2584006) | 2584006..2584158 | - | 153 | WP_002375510.1 | type I toxin-antitoxin system toxin PepG1 | - |
PML75_RS12260 (2584383) | 2584383..2585354 | - | 972 | WP_002381060.1 | ribose-phosphate diphosphokinase | - |
PML75_RS12265 (2585529) | 2585529..2585966 | - | 438 | WP_002354871.1 | peptide-methionine (R)-S-oxide reductase MsrB | - |
PML75_RS12270 (2586099) | 2586099..2586653 | - | 555 | WP_002354869.1 | Maf family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3799.63 Da Isoelectric Point: 10.0079
>T268869 WP_023894767.1 NZ_CP116555:c2583735-2583631 [Enterococcus faecalis]
MSAYETIQTILGFGMFTIALIALIVKLLKNDNKK
MSAYETIQTILGFGMFTIALIALIVKLLKNDNKK
Download Length: 105 bp
Antitoxin
Download Length: 188 bp
>AT268869 NZ_CP116555:2583511-2583698 [Enterococcus faecalis]
TGTGCTATAATGAAAACGAAAAGAGAGATATGCGTCAACATACCTCTCTGATGTAGAGCCGTTTAAGACGGTGACTTTTT
GAATTATTTAAAAATAACCGTACTCGGTCAAAGTTGACGGTTATTTTTTATTGTCATTTTTAAGCAATTTAACAATCAGC
GCAATCAAAGCAATGGTAAACATACCAA
TGTGCTATAATGAAAACGAAAAGAGAGATATGCGTCAACATACCTCTCTGATGTAGAGCCGTTTAAGACGGTGACTTTTT
GAATTATTTAAAAATAACCGTACTCGGTCAAAGTTGACGGTTATTTTTTATTGTCATTTTTAAGCAATTTAACAATCAGC
GCAATCAAAGCAATGGTAAACATACCAA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|