Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | fst-RNAII/- |
Location | 312423..312617 | Replicon | chromosome |
Accession | NZ_CP116555 | ||
Organism | Enterococcus faecalis strain K70-12a |
Toxin (Protein)
Gene name | fst | Uniprot ID | - |
Locus tag | PML75_RS01540 | Protein ID | WP_015543884.1 |
Coordinates | 312522..312617 (-) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | RNAII | ||
Locus tag | - | ||
Coordinates | 312423..312487 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PML75_RS01525 (308048) | 308048..309796 | + | 1749 | WP_181033811.1 | PTS transporter subunit EIIC | - |
PML75_RS01530 (309787) | 309787..311820 | + | 2034 | WP_002383677.1 | BglG family transcription antiterminator | - |
PML75_RS01535 (311831) | 311831..312265 | + | 435 | WP_104807259.1 | PTS sugar transporter subunit IIA | - |
- (312423) | 312423..312487 | + | 65 | NuclAT_14 | - | Antitoxin |
PML75_RS01540 (312522) | 312522..312617 | - | 96 | WP_015543884.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
PML75_RS01545 (312863) | 312863..314635 | + | 1773 | WP_104807258.1 | PTS mannitol-specific transporter subunit IIBC | - |
PML75_RS01550 (314650) | 314650..315087 | + | 438 | WP_002355279.1 | PTS sugar transporter subunit IIA | - |
PML75_RS01555 (315102) | 315102..316256 | + | 1155 | WP_271867062.1 | mannitol-1-phosphate 5-dehydrogenase | - |
PML75_RS01560 (316325) | 316325..317440 | - | 1116 | WP_104807257.1 | FAD-dependent oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3659.47 Da Isoelectric Point: 4.6275
>T268864 WP_015543884.1 NZ_CP116555:c312617-312522 [Enterococcus faecalis]
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
Download Length: 96 bp
Antitoxin
Download Length: 65 bp
>AT268864 NZ_CP116555:312423-312487 [Enterococcus faecalis]
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGCAGTAGGGTGTCTTTTTTT
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGCAGTAGGGTGTCTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|