Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-ratA/- |
Location | 2622090..2622425 | Replicon | chromosome |
Accession | NZ_CP116553 | ||
Organism | Enterococcus faecalis strain K80-2b |
Toxin (Protein)
Gene name | txpA | Uniprot ID | - |
Locus tag | PML81_RS12290 | Protein ID | WP_002415596.1 |
Coordinates | 2622090..2622233 (+) | Length | 48 a.a. |
Antitoxin (RNA)
Gene name | ratA | ||
Locus tag | - | ||
Coordinates | 2622375..2622425 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PML81_RS12270 (2617158) | 2617158..2617373 | - | 216 | WP_002354768.1 | zinc ribbon domain-containing protein | - |
PML81_RS12275 (2617512) | 2617512..2618504 | + | 993 | WP_002358973.1 | biotin--[acetyl-CoA-carboxylase] ligase | - |
PML81_RS12280 (2618808) | 2618808..2619446 | - | 639 | WP_002375448.1 | lytic polysaccharide monooxygenase | - |
PML81_RS12285 (2620133) | 2620133..2621749 | + | 1617 | WP_002372620.1 | phosphatase PAP2/LCP family protein | - |
PML81_RS12290 (2622090) | 2622090..2622233 | + | 144 | WP_002415596.1 | type I toxin-antitoxin system toxin PepG1 | Toxin |
- (2622166) | 2622166..2622424 | - | 259 | NuclAT_3 | - | - |
- (2622375) | 2622375..2622425 | + | 51 | NuclAT_13 | - | Antitoxin |
PML81_RS12295 (2622426) | 2622426..2626193 | - | 3768 | WP_104807327.1 | WxL domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 48 a.a. Molecular weight: 5314.46 Da Isoelectric Point: 10.6323
>T268862 WP_002415596.1 NZ_CP116553:2622090-2622233 [Enterococcus faecalis]
MNVSAKIYERRGLLSAYETIQTILGFGMFTIALIALIVKLLKNDKKK
MNVSAKIYERRGLLSAYETIQTILGFGMFTIALIALIVKLLKNDKKK
Download Length: 144 bp
Antitoxin
Download Length: 51 bp
>AT268862 NZ_CP116553:2622375-2622425 [Enterococcus faecalis]
AATAAAAAATGCCCGAGCCTTAGAAAAATAAGAGGCTCGGGCATTTTTATT
AATAAAAAATGCCCGAGCCTTAGAAAAATAAGAGGCTCGGGCATTTTTATT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|