Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-ratA/- |
Location | 2543645..2543916 | Replicon | chromosome |
Accession | NZ_CP116553 | ||
Organism | Enterococcus faecalis strain K80-2b |
Toxin (Protein)
Gene name | txpA | Uniprot ID | - |
Locus tag | PML81_RS11945 | Protein ID | WP_002375510.1 |
Coordinates | 2543764..2543916 (-) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | ratA | ||
Locus tag | - | ||
Coordinates | 2543645..2543831 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PML81_RS11930 (2539612) | 2539612..2542356 | + | 2745 | WP_104807179.1 | glycosyl hydrolase family 65 protein | - |
PML81_RS11935 (2542371) | 2542371..2543021 | + | 651 | WP_002375514.1 | beta-phosphoglucomutase | - |
- (2543090) | 2543090..2543222 | + | 133 | NuclAT_12 | - | - |
- (2543269) | 2543269..2543456 | + | 188 | NuclAT_4 | - | - |
PML81_RS11940 (2543389) | 2543389..2543493 | - | 105 | WP_023894767.1 | putative holin-like toxin | - |
- (2543645) | 2543645..2543790 | + | 146 | NuclAT_11 | - | - |
- (2543645) | 2543645..2543831 | + | 187 | NuclAT_5 | - | Antitoxin |
PML81_RS11945 (2543764) | 2543764..2543916 | - | 153 | WP_002375510.1 | type I toxin-antitoxin system toxin PepG1 | Toxin |
PML81_RS11950 (2544141) | 2544141..2545112 | - | 972 | WP_002381060.1 | ribose-phosphate diphosphokinase | - |
PML81_RS11955 (2545287) | 2545287..2545724 | - | 438 | WP_002354871.1 | peptide-methionine (R)-S-oxide reductase MsrB | - |
PML81_RS11960 (2545857) | 2545857..2546411 | - | 555 | WP_002354869.1 | Maf family protein | - |
PML81_RS11965 (2546436) | 2546436..2548568 | - | 2133 | WP_002375508.1 | DNA mismatch repair endonuclease MutL | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5637.90 Da Isoelectric Point: 11.0942
>T268857 WP_002375510.1 NZ_CP116553:c2543916-2543764 [Enterococcus faecalis]
VVRMSALPKFTERRGLLSAYETIQTILGFGMFTIALIALIVKLLKNDKKK
VVRMSALPKFTERRGLLSAYETIQTILGFGMFTIALIALIVKLLKNDKKK
Download Length: 153 bp
Antitoxin
Download Length: 187 bp
>AT268857 NZ_CP116553:2543645-2543831 [Enterococcus faecalis]
TGTGCTATAATGAAAATGAAAAGAGAGATATGAGTCAACATACCTCTCTAGTGTAGAGCCGTTTGAGACGGTGACCGATT
GTATTATTTAAAAATAACCGTACTGGTCAAAGTAGACGGTTATTTTTTTTTGTCATTTTTAAGCAATTTCACAATCAGTG
CAATCAAAGCAATGGTAAACATACCAA
TGTGCTATAATGAAAATGAAAAGAGAGATATGAGTCAACATACCTCTCTAGTGTAGAGCCGTTTGAGACGGTGACCGATT
GTATTATTTAAAAATAACCGTACTGGTCAAAGTAGACGGTTATTTTTTTTTGTCATTTTTAAGCAATTTCACAATCAGTG
CAATCAAAGCAATGGTAAACATACCAA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|