Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yefM-yoeB (relBE)/Txe-RelB
Location 153987..154522 Replicon plasmid pK189-3-A
Accession NZ_CP116547
Organism Enterococcus faecium strain K189-3

Toxin (Protein)


Gene name yoeB Uniprot ID R2PQC0
Locus tag PML74_RS13650 Protein ID WP_002314366.1
Coordinates 153987..154259 (-) Length 91 a.a.

Antitoxin (Protein)


Gene name yefM Uniprot ID Q3Y220
Locus tag PML74_RS13655 Protein ID WP_002297422.1
Coordinates 154259..154522 (-) Length 88 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PML74_RS13615 (PML74_13615) 150245..150397 + 153 Protein_155 IS6 family transposase -
PML74_RS13620 (PML74_13620) 150431..150604 - 174 WP_229214455.1 hypothetical protein -
PML74_RS13625 (PML74_13625) 150616..151353 - 738 WP_002331331.1 S8 family serine peptidase -
PML74_RS13630 (PML74_13630) 151613..152161 - 549 WP_002292681.1 hypothetical protein -
PML74_RS13635 (PML74_13635) 152162..153019 - 858 WP_002292680.1 ParA family protein -
PML74_RS13640 (PML74_13640) 153304..153591 - 288 WP_002300557.1 type II toxin-antitoxin system RelE/ParE family toxin -
PML74_RS13645 (PML74_13645) 153581..153910 - 330 WP_002292678.1 AbrB family transcriptional regulator -
PML74_RS13650 (PML74_13650) 153987..154259 - 273 WP_002314366.1 Txe/YoeB family addiction module toxin Toxin
PML74_RS13655 (PML74_13655) 154259..154522 - 264 WP_002297422.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
PML74_RS13660 (PML74_13660) 154628..155551 - 924 WP_002331332.1 hypothetical protein -
PML74_RS13665 (PML74_13665) 156110..156427 - 318 WP_002290394.1 type II toxin-antitoxin system RelE/ParE family toxin -
PML74_RS13670 (PML74_13670) 156428..156682 - 255 WP_002297424.1 hypothetical protein -
PML74_RS13675 (PML74_13675) 156942..157082 - 141 WP_002290398.1 hypothetical protein -
PML74_RS13680 (PML74_13680) 157720..157806 - 87 Protein_168 single-stranded DNA-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..158971 158971


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin YoeB

(9-87)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(5-69)


Sequences

Toxin        


Download         Length: 91 a.a.        Molecular weight: 10780.24 Da        Isoelectric Point: 9.9724

>T268843 WP_002314366.1 NZ_CP116547:c154259-153987 [Enterococcus faecium]
MNNYSVMIKNSAKADLKKIKQSNLKPQFEKVIQTLKEDPYLPTQSFEKLKPTHEGRYSRRLNRQHRVVYKVDEDEHVVEI
YSARTHYESQ

Download         Length: 273 bp

Antitoxin


Download         Length: 88 a.a.        Molecular weight: 9959.22 Da        Isoelectric Point: 4.5370

>AT268843 WP_002297422.1 NZ_CP116547:c154522-154259 [Enterococcus faecium]
MAKTVLNPSSARKNFYKLLKDVNENHTEIEIISERSENNAVLIGLDDWKAIKETLLLEQIGTLGVVRKREKDDSGFTNVD
EIDWDNL

Download         Length: 264 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829F704

Antitoxin

Source ID Structure
AlphaFold DB A0A829F006

References