Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 936825..937420 | Replicon | chromosome |
| Accession | NZ_CP116496 | ||
| Organism | MAG: Rickettsia asembonensis isolate Perak | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | PG979_RS05260 | Protein ID | WP_277360378.1 |
| Coordinates | 936825..937103 (+) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PG979_RS05265 | Protein ID | WP_041077923.1 |
| Coordinates | 937118..937420 (+) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PG979_RS05230 (PG979_001068) | 932351..932593 | - | 243 | WP_277360376.1 | GIY-YIG nuclease family protein | - |
| PG979_RS05235 (PG979_001069) | 932671..933273 | - | 603 | WP_041077913.1 | peroxiredoxin | - |
| PG979_RS05240 (PG979_001070) | 933355..934290 | - | 936 | WP_041077915.1 | stomatin-like protein | - |
| PG979_RS05245 (PG979_001071) | 934353..934595 | - | 243 | WP_041077917.1 | hypothetical protein | - |
| PG979_RS05250 (PG979_001073) | 934662..936229 | - | 1568 | Protein_992 | phosphoethanolamine transferase | - |
| PG979_RS05255 (PG979_001074) | 936265..936729 | + | 465 | WP_277360377.1 | Holliday junction resolvase RuvX | - |
| PG979_RS05260 (PG979_001075) | 936825..937103 | + | 279 | WP_277360378.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PG979_RS05265 (PG979_001076) | 937118..937420 | + | 303 | WP_041077923.1 | HigA family addiction module antitoxin | Antitoxin |
| PG979_RS05270 | 937500..938353 | + | 854 | Protein_996 | SDR family oxidoreductase | - |
| PG979_RS05275 | 938393..938521 | - | 129 | WP_277361026.1 | palindromic element RPE4 domain-containing protein | - |
| PG979_RS05280 (PG979_001078) | 938552..939577 | + | 1026 | WP_041077927.1 | UDP-glucose 4-epimerase | - |
| PG979_RS05285 (PG979_001079) | 939570..940703 | + | 1134 | WP_277360379.1 | UDP-N-acetylglucosamine 2-epimerase (non-hydrolyzing) | - |
| PG979_RS05290 | 940663..941388 | + | 726 | Protein_1000 | hypothetical protein | - |
| PG979_RS05295 (PG979_001081) | 941404..941886 | + | 483 | Protein_1001 | class I SAM-dependent methyltransferase | - |
| PG979_RS05300 (PG979_001082) | 942093..942305 | + | 213 | WP_277360380.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 11135.90 Da Isoelectric Point: 9.6841
>T268814 WP_277360378.1 NZ_CP116496:936825-937103 [Rickettsia asembonensis]
MIISFKCKHTEKLHNRELVKRFEVFAEIARKKLFMLHTTVNLEDLRVPPSNRLESLKGDRKHQYSIHINSQWRICFIWHD
GNVHNVEIVDYH
MIISFKCKHTEKLHNRELVKRFEVFAEIARKKLFMLHTTVNLEDLRVPPSNRLESLKGDRKHQYSIHINSQWRICFIWHD
GNVHNVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|