Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 76798..77051 | Replicon | plasmid unnamed3 |
| Accession | NZ_CP116494 | ||
| Organism | Klebsiella pneumoniae strain XY05-03 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | PIB23_RS29705 | Protein ID | WP_001312851.1 |
| Coordinates | 76902..77051 (+) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 76798..76857 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PIB23_RS29665 (72180) | 72180..72524 | - | 345 | Protein_99 | IS6-like element IS26 family transposase | - |
| PIB23_RS29670 (72576) | 72576..73280 | - | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
| PIB23_RS29675 (73305) | 73305..73505 | + | 201 | WP_072354025.1 | hypothetical protein | - |
| PIB23_RS29680 (73525) | 73525..74271 | + | 747 | WP_000205770.1 | conjugal transfer pilus acetylase TraX | - |
| PIB23_RS29685 (74326) | 74326..74886 | + | 561 | WP_000139328.1 | fertility inhibition protein FinO | - |
| PIB23_RS29690 (75018) | 75018..75218 | + | 201 | WP_015059022.1 | hypothetical protein | - |
| PIB23_RS29695 (75604) | 75604..76203 | + | 600 | WP_032083981.1 | PIN domain-containing protein | - |
| PIB23_RS29700 (76265) | 76265..76597 | + | 333 | WP_152916585.1 | hypothetical protein | - |
| - (76798) | 76798..76857 | - | 60 | NuclAT_0 | - | Antitoxin |
| - (76798) | 76798..76857 | - | 60 | NuclAT_0 | - | Antitoxin |
| - (76798) | 76798..76857 | - | 60 | NuclAT_0 | - | Antitoxin |
| - (76798) | 76798..76857 | - | 60 | NuclAT_0 | - | Antitoxin |
| PIB23_RS29705 (76902) | 76902..77051 | + | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| PIB23_RS29710 (77335) | 77335..77583 | + | 249 | WP_000083837.1 | replication regulatory protein RepA | - |
| PIB23_RS29715 (77828) | 77828..77902 | + | 75 | WP_001375168.1 | RepA leader peptide Tap | - |
| PIB23_RS29720 (77895) | 77895..78752 | + | 858 | WP_032495102.1 | incFII family plasmid replication initiator RepA | - |
| PIB23_RS29725 (79691) | 79691..80344 | + | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
| PIB23_RS29730 (80437) | 80437..80694 | + | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| PIB23_RS29735 (80627) | 80627..81028 | + | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
| PIB23_RS29740 (81277) | 81277..81692 | + | 416 | Protein_114 | IS1-like element IS1B family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | blaSHV-12 / blaKPC-2 / blaCTX-M-65 | - | 1..85083 | 85083 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T268807 WP_001312851.1 NZ_CP116494:76902-77051 [Klebsiella pneumoniae]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 60 bp
>AT268807 NZ_CP116494:c76857-76798 [Klebsiella pneumoniae]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
