Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 202487..203214 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP116492 | ||
| Organism | Klebsiella pneumoniae strain XY05-03 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A7W3D9W1 |
| Locus tag | PIB23_RS28540 | Protein ID | WP_011251285.1 |
| Coordinates | 202487..202798 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PIB23_RS28545 | Protein ID | WP_011251286.1 |
| Coordinates | 202795..203214 (+) | Length | 140 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PIB23_RS28500 (PIB23_28500) | 197498..197992 | + | 495 | WP_011251274.1 | hypothetical protein | - |
| PIB23_RS28505 (PIB23_28505) | 197998..198438 | + | 441 | WP_011251275.1 | hypothetical protein | - |
| PIB23_RS28510 (PIB23_28510) | 198863..199819 | - | 957 | WP_011251280.1 | DsbA family protein | - |
| PIB23_RS28515 (PIB23_28515) | 199879..200220 | - | 342 | WP_011251281.1 | hypothetical protein | - |
| PIB23_RS28520 (PIB23_28520) | 200234..200545 | - | 312 | WP_011251282.1 | hypothetical protein | - |
| PIB23_RS28525 (PIB23_28525) | 200562..201011 | - | 450 | WP_011251283.1 | thioredoxin fold domain-containing protein | - |
| PIB23_RS28535 (PIB23_28535) | 201845..202282 | + | 438 | Protein_220 | DDE-type integrase/transposase/recombinase | - |
| PIB23_RS28540 (PIB23_28540) | 202487..202798 | + | 312 | WP_011251285.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| PIB23_RS28545 (PIB23_28545) | 202795..203214 | + | 420 | WP_011251286.1 | helix-turn-helix domain-containing protein | Antitoxin |
| PIB23_RS28550 (PIB23_28550) | 203361..204329 | + | 969 | WP_074428168.1 | IS5 family transposase | - |
| PIB23_RS28555 (PIB23_28555) | 204401..204766 | - | 366 | WP_048333448.1 | hypothetical protein | - |
| PIB23_RS28560 (PIB23_28560) | 204780..205568 | - | 789 | WP_040217257.1 | hypothetical protein | - |
| PIB23_RS28565 (PIB23_28565) | 205589..206209 | - | 621 | WP_223175004.1 | conjugative transfer protein MobI(A/C) | - |
| PIB23_RS28570 (PIB23_28570) | 206628..207263 | + | 636 | WP_223171879.1 | hypothetical protein | - |
| PIB23_RS28575 (PIB23_28575) | 207576..208046 | + | 471 | WP_048333570.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | - | rmpA2 / iutA / iucD / iucC / iucB / iucA / rmpA / iroN | 1..218592 | 218592 | |
| - | inside | IScluster/Tn | - | - | 195578..215830 | 20252 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12346.12 Da Isoelectric Point: 9.7248
>T268804 WP_011251285.1 NZ_CP116492:202487-202798 [Klebsiella pneumoniae]
MHVISKEPFEEAAKRYPNDSLAIRALYRLVRETDFSSPAEMLTLIPSLDNFKYRNKWWVLDVGGNNLRVIAYINFVNKRF
YVKHIATHADYDKLTRYYRENKE
MHVISKEPFEEAAKRYPNDSLAIRALYRLVRETDFSSPAEMLTLIPSLDNFKYRNKWWVLDVGGNNLRVIAYINFVNKRF
YVKHIATHADYDKLTRYYRENKE
Download Length: 312 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15377.46 Da Isoelectric Point: 4.4420
>AT268804 WP_011251286.1 NZ_CP116492:202795-203214 [Klebsiella pneumoniae]
MITDTAKAIEATKQLVAAVPFLGGSSSESDYREAMELVDYLIENDDENPLIDFLASKIADYEDNSPRFAEFNKAIAEIPV
GVALLRTLIDQHKLSYSDLKDEIGSKSLVSQILSGQRSLTITHIKALSARFGVKPEWFL
MITDTAKAIEATKQLVAAVPFLGGSSSESDYREAMELVDYLIENDDENPLIDFLASKIADYEDNSPRFAEFNKAIAEIPV
GVALLRTLIDQHKLSYSDLKDEIGSKSLVSQILSGQRSLTITHIKALSARFGVKPEWFL
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|