Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 1653254..1653893 | Replicon | chromosome |
Accession | NZ_CP116490 | ||
Organism | Haemophilus influenzae strain 93P10H1 |
Toxin (Protein)
Gene name | higB | Uniprot ID | Q4QJX7 |
Locus tag | BV187_RS08130 | Protein ID | WP_005650215.1 |
Coordinates | 1653588..1653893 (-) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | BV187_RS08125 | Protein ID | WP_005650217.1 |
Coordinates | 1653254..1653577 (-) | Length | 108 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BV187_RS08105 (BV187_1641) | 1648873..1649046 | - | 174 | WP_011272700.1 | DUF5363 domain-containing protein | - |
BV187_RS08110 (BV187_1642) | 1649043..1651013 | - | 1971 | WP_011961904.1 | GNAT family N-acetyltransferase | - |
BV187_RS08115 (BV187_1643) | 1651018..1651359 | - | 342 | WP_005652996.1 | SirB2 family protein | - |
BV187_RS08120 (BV187_1644) | 1651421..1653091 | - | 1671 | WP_005650218.1 | energy-dependent translational throttle protein EttA | - |
BV187_RS08125 (BV187_1645) | 1653254..1653577 | - | 324 | WP_005650217.1 | HigA family addiction module antitoxin | Antitoxin |
BV187_RS08130 (BV187_1646) | 1653588..1653893 | - | 306 | WP_005650215.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
BV187_RS08135 (BV187_1647) | 1654218..1654838 | + | 621 | WP_005666732.1 | zinc transporter binding subunit ZevA | - |
BV187_RS08140 (BV187_1648) | 1654841..1655809 | + | 969 | WP_005666730.1 | zinc transporter permease subunit ZevB | - |
BV187_RS08150 (BV187_1650) | 1656424..1658463 | + | 2040 | WP_005687320.1 | excinuclease ABC subunit UvrB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 12301.93 Da Isoelectric Point: 9.0853
>T268787 WP_005650215.1 NZ_CP116490:c1653893-1653588 [Haemophilus influenzae]
MFNLKREHFRDDYLYRFYQYGDTHSKIPSNLYKVLARKLDMISASENINDLRSPPANHLELLEPKENKIYSIRVNKQYRL
IFKYENNEVNNLYLDPHSYNL
MFNLKREHFRDDYLYRFYQYGDTHSKIPSNLYKVLARKLDMISASENINDLRSPPANHLELLEPKENKIYSIRVNKQYRL
IFKYENNEVNNLYLDPHSYNL
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|