Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 1435494..1436133 | Replicon | chromosome |
Accession | NZ_CP116489 | ||
Organism | Haemophilus influenzae strain 93P28H1 |
Toxin (Protein)
Gene name | higB | Uniprot ID | Q4QJX7 |
Locus tag | BV189_RS07045 | Protein ID | WP_005650215.1 |
Coordinates | 1435494..1435799 (+) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | BV189_RS07050 | Protein ID | WP_005650217.1 |
Coordinates | 1435810..1436133 (+) | Length | 108 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BV189_RS07025 (BV189_1421) | 1430924..1432963 | - | 2040 | WP_005687320.1 | excinuclease ABC subunit UvrB | - |
BV189_RS07035 (BV189_1423) | 1433578..1434546 | - | 969 | WP_005666730.1 | zinc transporter permease subunit ZevB | - |
BV189_RS07040 (BV189_1424) | 1434549..1435169 | - | 621 | WP_005666732.1 | zinc transporter binding subunit ZevA | - |
BV189_RS07045 (BV189_1425) | 1435494..1435799 | + | 306 | WP_005650215.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
BV189_RS07050 (BV189_1426) | 1435810..1436133 | + | 324 | WP_005650217.1 | HigA family addiction module antitoxin | Antitoxin |
BV189_RS07055 (BV189_1427) | 1436296..1437966 | + | 1671 | WP_005650218.1 | energy-dependent translational throttle protein EttA | - |
BV189_RS07060 (BV189_1428) | 1438028..1438369 | + | 342 | WP_005652996.1 | SirB2 family protein | - |
BV189_RS07065 (BV189_1429) | 1438374..1440344 | + | 1971 | WP_011961904.1 | GNAT family N-acetyltransferase | - |
BV189_RS07070 (BV189_1430) | 1440341..1440514 | + | 174 | WP_011272700.1 | DUF5363 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 12301.93 Da Isoelectric Point: 9.0853
>T268778 WP_005650215.1 NZ_CP116489:1435494-1435799 [Haemophilus influenzae]
MFNLKREHFRDDYLYRFYQYGDTHSKIPSNLYKVLARKLDMISASENINDLRSPPANHLELLEPKENKIYSIRVNKQYRL
IFKYENNEVNNLYLDPHSYNL
MFNLKREHFRDDYLYRFYQYGDTHSKIPSNLYKVLARKLDMISASENINDLRSPPANHLELLEPKENKIYSIRVNKQYRL
IFKYENNEVNNLYLDPHSYNL
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|