Detailed information of TA system TA268767

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 45619..46045
• Replicon: plasmid unnamed2
• Accession: NZ_CP116482
• Organism: Escherichia coli strain GTEN_24

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: E5Q65_RS24345
• Protein ID: WP_001372321.1
• Coordinates: 45619..45744 (-)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	45821..46045 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
E5Q65_RS24305 (40991)	40991..41680	-	690	WP_000283380.1	conjugal transfer transcriptional regulator TraJ	-
E5Q65_RS24310 (41867)	41867..42250	-	384	WP_001151524.1	conjugal transfer relaxosome DNA-binding protein TraM	-
E5Q65_RS24315 (42583)	42583..43173	+	591	WP_165899088.1	transglycosylase SLT domain-containing protein	-
E5Q65_RS24320 (43470)	43470..44291	-	822	WP_001234469.1	DUF932 domain-containing protein	-
E5Q65_RS24325 (44410)	44410..44697	-	288	WP_065800506.1	hypothetical protein	-
E5Q65_RS24330 (44722)	44722..44928	-	207	WP_272056219.1	single-stranded DNA-binding protein	-
E5Q65_RS24335 (44998)	44998..45171	+	174	Protein_44	hypothetical protein	-
E5Q65_RS24340 (45169)	45169..45399	-	231	WP_001426396.1	hypothetical protein	-
E5Q65_RS24345 (45619)	45619..45744	-	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
E5Q65_RS24350 (45686)	45686..45835	-	150	Protein_47	plasmid maintenance protein Mok	-
- (45823)	45823..45888	+	66	NuclAT_0	-	-
- (45823)	45823..45888	-	66	NuclAT_1	-	-
- (45821)	45821..46045	+	225	NuclAT_0	-	-
- (45821)	45821..46045	-	225	NuclAT_0	-	Antitoxin
- (45821)	45821..46045	-	225	NuclAT_0	-	Antitoxin
- (45821)	45821..46045	-	225	NuclAT_0	-	Antitoxin
- (45821)	45821..46045	-	225	NuclAT_0	-	Antitoxin
E5Q65_RS24355 (46014)	46014..46776	-	763	Protein_48	plasmid SOS inhibition protein A	-
E5Q65_RS24360 (46773)	46773..47207	-	435	WP_000845934.1	conjugation system SOS inhibitor PsiB	-
E5Q65_RS24365 (47262)	47262..49220	-	1959	WP_272056222.1	ParB/RepB/Spo0J family partition protein	-
E5Q65_RS24370 (49286)	49286..49519	-	234	WP_000005990.1	DUF905 family protein	-
E5Q65_RS24375 (49582)	49582..50121	-	540	WP_000290791.1	single-stranded DNA-binding protein	-
E5Q65_RS24380 (50594)	50594..50854	-	261	WP_071600428.1	hypothetical protein	-
E5Q65_RS24385 (50764)	50764..51006	-	243	WP_001299722.1	hypothetical protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T268767 WP_001372321.1 NZ_CP116482:c45744-45619 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 225 bp

>AT268767 NZ_CP116482:c46045-45821 [Escherichia coli]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin