Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 77000..77240 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP116481 | ||
| Organism | Escherichia coli strain GTEN_24 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | E5Q65_RS23765 | Protein ID | WP_001372321.1 |
| Coordinates | 77000..77125 (-) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 77202..77240 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| E5Q65_RS23720 (72112) | 72112..72339 | - | 228 | WP_001254388.1 | conjugal transfer relaxosome protein TraY | - |
| E5Q65_RS23725 (72427) | 72427..73104 | - | 678 | WP_001348626.1 | PAS domain-containing protein | - |
| E5Q65_RS23730 (73238) | 73238..73621 | - | 384 | WP_001151566.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| E5Q65_RS23735 (73952) | 73952..74554 | + | 603 | WP_000243712.1 | transglycosylase SLT domain-containing protein | - |
| E5Q65_RS23740 (74851) | 74851..75672 | - | 822 | WP_001234469.1 | DUF932 domain-containing protein | - |
| E5Q65_RS23745 (75791) | 75791..76078 | - | 288 | WP_000107535.1 | hypothetical protein | - |
| E5Q65_RS23750 (76103) | 76103..76309 | - | 207 | WP_000275859.1 | hypothetical protein | - |
| E5Q65_RS23755 (76379) | 76379..76552 | + | 174 | Protein_95 | hypothetical protein | - |
| E5Q65_RS23760 (76550) | 76550..76780 | - | 231 | WP_001426396.1 | hypothetical protein | - |
| E5Q65_RS23765 (77000) | 77000..77125 | - | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| E5Q65_RS23770 (77067) | 77067..77216 | - | 150 | Protein_98 | plasmid maintenance protein Mok | - |
| - (77202) | 77202..77240 | - | 39 | NuclAT_1 | - | Antitoxin |
| - (77202) | 77202..77240 | - | 39 | NuclAT_1 | - | Antitoxin |
| - (77202) | 77202..77240 | - | 39 | NuclAT_1 | - | Antitoxin |
| - (77202) | 77202..77240 | - | 39 | NuclAT_1 | - | Antitoxin |
| - (78680) | 78680..78782 | - | 103 | NuclAT_0 | - | - |
| - (78680) | 78680..78782 | - | 103 | NuclAT_0 | - | - |
| - (78680) | 78680..78782 | - | 103 | NuclAT_0 | - | - |
| - (78680) | 78680..78782 | - | 103 | NuclAT_0 | - | - |
| E5Q65_RS23780 (78751) | 78751..79513 | - | 763 | Protein_100 | plasmid SOS inhibition protein A | - |
| E5Q65_RS23785 (79510) | 79510..79944 | - | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
| E5Q65_RS23790 (80013) | 80013..82036 | - | 2024 | Protein_102 | ParB/RepB/Spo0J family partition protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | tet(B) / catA1 / sul1 / qacE / aadA2 / dfrA12 / qepA4 / mph(A) / erm(B) / msr(E) / mph(E) / qnrB4 / blaDHA-1 | - | 1..138420 | 138420 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T268762 WP_001372321.1 NZ_CP116481:c77125-77000 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 39 bp
>AT268762 NZ_CP116481:c77240-77202 [Escherichia coli]
CATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
CATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
