Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 48531..48770 Replicon plasmid unnamed1
Accession NZ_CP116481
Organism Escherichia coli strain GTEN_24

Toxin (Protein)


Gene name srnB Uniprot ID A0A762TWR7
Locus tag E5Q65_RS23595 Protein ID WP_023144756.1
Coordinates 48531..48665 (-) Length 45 a.a.

Antitoxin (RNA)


Gene name srnC
Locus tag -
Coordinates 48710..48770 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
E5Q65_RS23570 (44232) 44232..45089 - 858 WP_000130646.1 incFII family plasmid replication initiator RepA -
E5Q65_RS23575 (45082) 45082..45156 - 75 WP_014966221.1 RepA leader peptide Tap -
E5Q65_RS23580 (45518) 45518..47059 + 1542 WP_002431311.1 IS21-like element ISEc12 family transposase -
E5Q65_RS23585 (47074) 47074..47820 + 747 WP_001016257.1 IS21-like element ISEc12 family helper ATPase IstB -
E5Q65_RS23590 (47980) 47980..48234 - 255 WP_000083850.1 replication regulatory protein RepA -
E5Q65_RS23595 (48531) 48531..48665 - 135 WP_023144756.1 Hok/Gef family protein Toxin
- (48710) 48710..48770 + 61 NuclAT_2 - Antitoxin
- (48710) 48710..48770 + 61 NuclAT_2 - Antitoxin
- (48710) 48710..48770 + 61 NuclAT_2 - Antitoxin
- (48710) 48710..48770 + 61 NuclAT_2 - Antitoxin
E5Q65_RS23600 (48737) 48737..49023 - 287 Protein_64 DUF2726 domain-containing protein -
E5Q65_RS23605 (49536) 49536..49748 - 213 WP_013023861.1 hypothetical protein -
E5Q65_RS23610 (49879) 49879..50439 - 561 WP_000139341.1 fertility inhibition protein FinO -
E5Q65_RS23615 (50494) 50494..51240 - 747 WP_023909066.1 conjugal transfer pilus acetylase TraX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid tet(B) / catA1 / sul1 / qacE / aadA2 / dfrA12 / qepA4 / mph(A) / erm(B) / msr(E) / mph(E) / qnrB4 / blaDHA-1 - 1..138420 138420


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(4-44)


Sequences

Toxin        


Download         Length: 45 a.a.        Molecular weight: 4896.90 Da        Isoelectric Point: 7.7209

>T268761 WP_023144756.1 NZ_CP116481:c48665-48531 [Escherichia coli]
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA

Download         Length: 135 bp

Antitoxin


Download         Length: 61 bp

>AT268761 NZ_CP116481:48710-48770 [Escherichia coli]
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A762TWR7

Antitoxin

Download structure file

References