Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
| Location | 4393785..4394464 | Replicon | chromosome |
| Accession | NZ_CP116480 | ||
| Organism | Escherichia coli strain GTEN_24 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | U9XN95 |
| Locus tag | E5Q65_RS21210 | Protein ID | WP_000057540.1 |
| Coordinates | 4393785..4394087 (+) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | S1QAY3 |
| Locus tag | E5Q65_RS21215 | Protein ID | WP_000806442.1 |
| Coordinates | 4394123..4394464 (+) | Length | 114 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| E5Q65_RS21190 (4389048) | 4389048..4390268 | - | 1221 | WP_001251608.1 | fosmidomycin MFS transporter | - |
| E5Q65_RS21195 (4390486) | 4390486..4392138 | + | 1653 | WP_000771768.1 | bifunctional UDP-sugar hydrolase/5'-nucleotidase | - |
| E5Q65_RS21200 (4392175) | 4392175..4392654 | - | 480 | WP_000186631.1 | Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK | - |
| E5Q65_RS21205 (4392858) | 4392858..4393652 | - | 795 | WP_000365180.1 | TraB/GumN family protein | - |
| E5Q65_RS21210 (4393785) | 4393785..4394087 | + | 303 | WP_000057540.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| E5Q65_RS21215 (4394123) | 4394123..4394464 | + | 342 | WP_000806442.1 | HigA family addiction module antitoxin | Antitoxin |
| E5Q65_RS21220 (4394522) | 4394522..4397026 | - | 2505 | WP_023155691.1 | copper-exporting P-type ATPase CopA | - |
| E5Q65_RS21225 (4397288) | 4397288..4398220 | + | 933 | WP_023155692.1 | glutaminase A | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11781.35 Da Isoelectric Point: 10.2638
>T268760 WP_000057540.1 NZ_CP116480:4393785-4394087 [Escherichia coli]
MAQKNNIRSFRDAWLADFFVHSTPHRKIPAEIHTSLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
MAQKNNIRSFRDAWLADFFVHSTPHRKIPAEIHTSLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|