Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 3257673..3258275 | Replicon | chromosome |
| Accession | NZ_CP116480 | ||
| Organism | Escherichia coli strain GTEN_24 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | U9XIS6 |
| Locus tag | E5Q65_RS15775 | Protein ID | WP_000897305.1 |
| Coordinates | 3257673..3257984 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | E5Q65_RS15780 | Protein ID | WP_000356397.1 |
| Coordinates | 3257985..3258275 (+) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| E5Q65_RS15745 (3252703) | 3252703..3253488 | + | 786 | WP_000059678.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| E5Q65_RS15750 (3253587) | 3253587..3254186 | + | 600 | WP_001295269.1 | glucose-1-phosphatase | - |
| E5Q65_RS15755 (3254180) | 3254180..3255052 | + | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
| E5Q65_RS15760 (3255049) | 3255049..3255486 | + | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
| E5Q65_RS15765 (3255531) | 3255531..3256472 | + | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
| E5Q65_RS15770 (3256536) | 3256536..3257444 | - | 909 | WP_001162704.1 | alpha/beta hydrolase | - |
| E5Q65_RS15775 (3257673) | 3257673..3257984 | + | 312 | WP_000897305.1 | hypothetical protein | Toxin |
| E5Q65_RS15780 (3257985) | 3257985..3258275 | + | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
| E5Q65_RS15785 (3258861) | 3258861..3259079 | + | 219 | WP_001295676.1 | CopG family transcriptional regulator | - |
| E5Q65_RS15790 (3259298) | 3259298..3259540 | + | 243 | WP_001086388.1 | protein YiiF | - |
| E5Q65_RS15795 (3259870) | 3259870..3260799 | - | 930 | WP_000027708.1 | formate dehydrogenase accessory protein FdhE | - |
| E5Q65_RS15800 (3260796) | 3260796..3261431 | - | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
| E5Q65_RS15805 (3261428) | 3261428..3262330 | - | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T268754 WP_000897305.1 NZ_CP116480:3257673-3257984 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|