Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 170823..171416 | Replicon | chromosome |
Accession | NZ_CP116478 | ||
Organism | Pseudomonas syringae pv. actinidiae strain PSA.AH.01 |
Toxin (Protein)
Gene name | graT | Uniprot ID | A0A2G7PD43 |
Locus tag | PHA47_RS00820 | Protein ID | WP_003377943.1 |
Coordinates | 170823..171101 (+) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | graA | Uniprot ID | Q88B19 |
Locus tag | PHA47_RS00825 | Protein ID | WP_005739893.1 |
Coordinates | 171111..171416 (+) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PHA47_RS00800 (PHA47_00800) | 165975..166808 | - | 834 | WP_005739898.1 | transporter substrate-binding domain-containing protein | - |
PHA47_RS00805 (PHA47_00805) | 166836..167708 | - | 873 | WP_005613618.1 | phytanoyl-CoA dioxygenase family protein | - |
PHA47_RS00810 (PHA47_00810) | 167733..169253 | - | 1521 | WP_024533279.1 | amino acid ABC transporter permease/ATP-binding protein | - |
PHA47_RS00815 (PHA47_00815) | 169738..170652 | + | 915 | WP_019332092.1 | LysR family transcriptional regulator | - |
PHA47_RS00820 (PHA47_00820) | 170823..171101 | + | 279 | WP_003377943.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PHA47_RS00825 (PHA47_00825) | 171111..171416 | + | 306 | WP_005739893.1 | HigA family addiction module antitoxin | Antitoxin |
PHA47_RS00830 (PHA47_00830) | 171450..171731 | - | 282 | WP_017682769.1 | accessory factor UbiK family protein | - |
PHA47_RS00835 (PHA47_00835) | 172151..172489 | + | 339 | WP_002555808.1 | P-II family nitrogen regulator | - |
PHA47_RS00840 (PHA47_00840) | 172524..173861 | + | 1338 | WP_003377937.1 | ammonium transporter | - |
PHA47_RS00845 (PHA47_00845) | 174104..174529 | + | 426 | WP_003377936.1 | secondary thiamine-phosphate synthase enzyme YjbQ | - |
PHA47_RS00850 (PHA47_00850) | 174628..174960 | + | 333 | WP_003377934.1 | transcriptional regulator SutA | - |
PHA47_RS00855 (PHA47_00855) | 175011..176348 | - | 1338 | WP_032685517.1 | IS4-like element ISPsy33 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10512.18 Da Isoelectric Point: 9.1490
>T268733 WP_003377943.1 NZ_CP116478:170823-171101 [Pseudomonas syringae pv. actinidiae]
MIVSFKCVHTRYLFLQGKTRLWPSIKSVAERKLAMLDAATSILDLRSPPGNRLEVLDGSRSGQYSVRINAQFRICFVWSI
NGPEDVEIVDYH
MIVSFKCVHTRYLFLQGKTRLWPSIKSVAERKLAMLDAATSILDLRSPPGNRLEVLDGSRSGQYSVRINAQFRICFVWSI
NGPEDVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2G7PD43 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0K8LYY6 |