Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
| Location | 3398565..3399259 | Replicon | chromosome |
| Accession | NZ_CP116477 | ||
| Organism | Pectobacterium sp. A5351 | ||
Toxin (Protein)
| Gene name | yafO | Uniprot ID | - |
| Locus tag | O1Q74_RS15720 | Protein ID | WP_271874564.1 |
| Coordinates | 3398565..3398969 (-) | Length | 135 a.a. |
Antitoxin (Protein)
| Gene name | yafN | Uniprot ID | - |
| Locus tag | O1Q74_RS15725 | Protein ID | WP_226308436.1 |
| Coordinates | 3398966..3399259 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O1Q74_RS15710 (O1Q74_15710) | 3394069..3395787 | + | 1719 | WP_271874562.1 | proline--tRNA ligase | - |
| O1Q74_RS15715 (O1Q74_15715) | 3396012..3398234 | - | 2223 | WP_271874563.1 | ferric-rhodotorulic acid/ferric-coprogen receptor FhuE | - |
| O1Q74_RS15720 (O1Q74_15720) | 3398565..3398969 | - | 405 | WP_271874564.1 | type II toxin-antitoxin system YafO family toxin | Toxin |
| O1Q74_RS15725 (O1Q74_15725) | 3398966..3399259 | - | 294 | WP_226308436.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
| O1Q74_RS15730 (O1Q74_15730) | 3399798..3400211 | + | 414 | WP_271874565.1 | GNAT family N-acetyltransferase | - |
| O1Q74_RS15735 (O1Q74_15735) | 3400241..3400930 | + | 690 | WP_271874566.1 | LuxR C-terminal-related transcriptional regulator | - |
| O1Q74_RS15740 (O1Q74_15740) | 3400945..3402261 | + | 1317 | WP_271874567.1 | cytosine permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 135 a.a. Molecular weight: 15612.07 Da Isoelectric Point: 7.9352
>T268729 WP_271874564.1 NZ_CP116477:c3398969-3398565 [Pectobacterium sp. A5351]
MSIRIFKSTLLCQQLSQQELDDLVADFLSYKQDGVLPDTFGRDALYDDDRTYPLVRKEQVAHIHLADAHAPFPKFLRQFK
RTSDKAHLVYCQSAMDPDIYLLIIILKPEAHKMARNNNNMHKVGVMPEAFRMKY
MSIRIFKSTLLCQQLSQQELDDLVADFLSYKQDGVLPDTFGRDALYDDDRTYPLVRKEQVAHIHLADAHAPFPKFLRQFK
RTSDKAHLVYCQSAMDPDIYLLIIILKPEAHKMARNNNNMHKVGVMPEAFRMKY
Download Length: 405 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|