Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 31943..32615 | Replicon | chromosome |
| Accession | NZ_CP116477 | ||
| Organism | Pectobacterium sp. A5351 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | O1Q74_RS00190 | Protein ID | WP_271875380.1 |
| Coordinates | 32229..32615 (-) | Length | 129 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | O1Q74_RS00185 | Protein ID | WP_180779427.1 |
| Coordinates | 31943..32242 (-) | Length | 100 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O1Q74_RS00165 (O1Q74_00165) | 27196..28185 | + | 990 | WP_271875371.1 | nucleoside hydrolase | - |
| O1Q74_RS00170 (O1Q74_00170) | 28185..29162 | + | 978 | WP_271875373.1 | ABC transporter permease | - |
| O1Q74_RS00175 (O1Q74_00175) | 29159..30067 | + | 909 | WP_271875375.1 | ABC transporter permease | - |
| O1Q74_RS00180 (O1Q74_00180) | 30107..31906 | + | 1800 | WP_271875376.1 | ABC transporter ATP-binding protein | - |
| O1Q74_RS00185 (O1Q74_00185) | 31943..32242 | - | 300 | WP_180779427.1 | XRE family transcriptional regulator | Antitoxin |
| O1Q74_RS00190 (O1Q74_00190) | 32229..32615 | - | 387 | WP_271875380.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| O1Q74_RS00195 (O1Q74_00195) | 32879..33376 | + | 498 | WP_271875382.1 | GNAT family N-acetyltransferase | - |
| O1Q74_RS00200 (O1Q74_00200) | 33576..33833 | - | 258 | WP_012772768.1 | DUF1471 domain-containing protein | - |
| O1Q74_RS00205 (O1Q74_00205) | 34006..34806 | - | 801 | WP_271875385.1 | aliphatic sulfonates ABC transporter ATP-binding protein | - |
| O1Q74_RS00210 (O1Q74_00210) | 34803..35597 | - | 795 | WP_271875387.1 | aliphatic sulfonate ABC transporter permease SsuC | - |
| O1Q74_RS00215 (O1Q74_00215) | 35609..36751 | - | 1143 | WP_271875389.1 | FMNH2-dependent alkanesulfonate monooxygenase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14892.88 Da Isoelectric Point: 4.6333
>T268713 WP_271875380.1 NZ_CP116477:c32615-32229 [Pectobacterium sp. A5351]
MEVYRLAWEIVTRALFDTWFDEQTETVQEEVLAHLGILEEDGPQLGRPQVDQIKGSQYKNMKELRVQVGDHPFRTFFAFD
RTRKAIVLCAGDKKGENEKLFYERMIKIADAEFTSHLISPEVKEDGDI
MEVYRLAWEIVTRALFDTWFDEQTETVQEEVLAHLGILEEDGPQLGRPQVDQIKGSQYKNMKELRVQVGDHPFRTFFAFD
RTRKAIVLCAGDKKGENEKLFYERMIKIADAEFTSHLISPEVKEDGDI
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|