Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mqsRA (relBE)/MqsA(antitoxin) |
Location | 1845719..1846311 | Replicon | chromosome |
Accession | NZ_CP116458 | ||
Organism | Acidithiobacillus ferriphilus strain YL25 |
Toxin (Protein)
Gene name | mqsR | Uniprot ID | - |
Locus tag | PJU76_RS09305 | Protein ID | WP_271779301.1 |
Coordinates | 1846129..1846311 (-) | Length | 61 a.a. |
Antitoxin (Protein)
Gene name | mqsA | Uniprot ID | - |
Locus tag | PJU76_RS09300 | Protein ID | WP_271779300.1 |
Coordinates | 1845719..1846126 (-) | Length | 136 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PJU76_RS09285 (PJU76_09285) | 1841451..1842563 | - | 1113 | WP_271779297.1 | sigma-54 dependent transcriptional regulator | - |
PJU76_RS09290 (PJU76_09290) | 1842855..1843802 | - | 948 | WP_271779298.1 | chemotaxis protein | - |
PJU76_RS09295 (PJU76_09295) | 1843814..1845064 | - | 1251 | WP_271779299.1 | methyl-accepting chemotaxis protein | - |
PJU76_RS09300 (PJU76_09300) | 1845719..1846126 | - | 408 | WP_271779300.1 | type II toxin-antitoxin system MqsA family antitoxin | Antitoxin |
PJU76_RS09305 (PJU76_09305) | 1846129..1846311 | - | 183 | WP_271779301.1 | hypothetical protein | Toxin |
PJU76_RS09310 (PJU76_09310) | 1846467..1847240 | + | 774 | WP_271779302.1 | DUF4113 domain-containing protein | - |
PJU76_RS09315 (PJU76_09315) | 1847514..1848629 | + | 1116 | WP_271779303.1 | hypothetical protein | - |
PJU76_RS09320 (PJU76_09320) | 1848795..1849319 | + | 525 | WP_271779304.1 | hypothetical protein | - |
PJU76_RS09325 (PJU76_09325) | 1849536..1849844 | + | 309 | WP_271779305.1 | roadblock/LC7 domain-containing protein | - |
PJU76_RS09330 (PJU76_09330) | 1849893..1850255 | + | 363 | WP_271779306.1 | roadblock/LC7 domain-containing protein | - |
PJU76_RS09335 (PJU76_09335) | 1850422..1850973 | + | 552 | WP_271779307.1 | protoglobin domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6420.67 Da Isoelectric Point: 9.4060
>T268711 WP_271779301.1 NZ_CP116458:c1846311-1846129 [Acidithiobacillus ferriphilus]
MEKGILHCKLATVKALTEAGKVNTTASAFKGARELGINDLAGMCTMPRQITVLIVSFKEL
MEKGILHCKLATVKALTEAGKVNTTASAFKGARELGINDLAGMCTMPRQITVLIVSFKEL
Download Length: 183 bp
Antitoxin
Download Length: 136 a.a. Molecular weight: 14917.17 Da Isoelectric Point: 8.0216
>AT268711 WP_271779300.1 NZ_CP116458:c1846126-1845719 [Acidithiobacillus ferriphilus]
MKCPCCGVAELIHDTRDMPYIYKGETTTIPAVTGDFCPACGEVVLNREYGGRYSELIGQFQRQVNSAYVDPHYIALVRKK
LDLDQRQAAAIFGGGANAFSRYENGKTKPSLALVKLLKVLERHPDLLNEVKSGPV
MKCPCCGVAELIHDTRDMPYIYKGETTTIPAVTGDFCPACGEVVLNREYGGRYSELIGQFQRQVNSAYVDPHYIALVRKK
LDLDQRQAAAIFGGGANAFSRYENGKTKPSLALVKLLKVLERHPDLLNEVKSGPV
Download Length: 408 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|