Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 638018..638850 | Replicon | chromosome |
Accession | NZ_CP116458 | ||
Organism | Acidithiobacillus ferriphilus strain YL25 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | - |
Locus tag | PJU76_RS03165 | Protein ID | WP_271780451.1 |
Coordinates | 638344..638850 (+) | Length | 169 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | - |
Locus tag | PJU76_RS03160 | Protein ID | WP_271781035.1 |
Coordinates | 638018..638347 (+) | Length | 110 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PJU76_RS03120 (PJU76_03120) | 633533..634003 | + | 471 | WP_271781034.1 | N-6 DNA methylase | - |
PJU76_RS03125 (PJU76_03125) | 634046..634327 | + | 282 | WP_271780445.1 | BrnT family toxin | - |
PJU76_RS03130 (PJU76_03130) | 634278..634610 | + | 333 | WP_271780446.1 | BrnA antitoxin family protein | - |
PJU76_RS03135 (PJU76_03135) | 634654..635499 | - | 846 | WP_271780447.1 | thioredoxin fold domain-containing protein | - |
PJU76_RS03140 (PJU76_03140) | 636223..636537 | - | 315 | WP_271780448.1 | DUF86 domain-containing protein | - |
PJU76_RS03145 (PJU76_03145) | 636534..636824 | - | 291 | WP_271780449.1 | nucleotidyltransferase domain-containing protein | - |
PJU76_RS03150 (PJU76_03150) | 637077..637307 | + | 231 | WP_271780450.1 | hypothetical protein | - |
PJU76_RS03155 (PJU76_03155) | 637409..637846 | + | 438 | Protein_622 | IS3 family transposase | - |
PJU76_RS03160 (PJU76_03160) | 638018..638347 | + | 330 | WP_271781035.1 | type II toxin-antitoxin system PrlF family antitoxin | Antitoxin |
PJU76_RS03165 (PJU76_03165) | 638344..638850 | + | 507 | WP_271780451.1 | type II toxin-antitoxin system YhaV family toxin | Toxin |
PJU76_RS03170 (PJU76_03170) | 640572..642734 | - | 2163 | WP_271780452.1 | TniQ family protein | - |
PJU76_RS03175 (PJU76_03175) | 642734..643720 | - | 987 | WP_229066188.1 | TniB family NTP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 629929..672774 | 42845 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 169 a.a. Molecular weight: 19620.45 Da Isoelectric Point: 10.2710
>T268708 WP_271780451.1 NZ_CP116458:638344-638850 [Acidithiobacillus ferriphilus]
MNLGKPDPLVIHGWTVFVHPLFLAQLEALARQVGAFKQKDPVGYVKKNASKRLAAITKLAFDVIPQNPARPEYRQGNTLG
DEYKHWFRARFFQQYRLFFRYHASSKVIVFVWVNDEDTKRAYESSDDAYRVFRKMLESGHPPDDWKHLLAEARAERQRLQ
PFTSAITP
MNLGKPDPLVIHGWTVFVHPLFLAQLEALARQVGAFKQKDPVGYVKKNASKRLAAITKLAFDVIPQNPARPEYRQGNTLG
DEYKHWFRARFFQQYRLFFRYHASSKVIVFVWVNDEDTKRAYESSDDAYRVFRKMLESGHPPDDWKHLLAEARAERQRLQ
PFTSAITP
Download Length: 507 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|