Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 4622406..4623008 | Replicon | chromosome |
Accession | NZ_CP116411 | ||
Organism | Escherichia coli strain HH45 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9XIS6 |
Locus tag | PL330_RS21950 | Protein ID | WP_000897305.1 |
Coordinates | 4622697..4623008 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | PL330_RS21945 | Protein ID | WP_000356397.1 |
Coordinates | 4622406..4622696 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PL330_RS21920 (4618332) | 4618332..4619234 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
PL330_RS21925 (4619231) | 4619231..4619866 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
PL330_RS21930 (4619863) | 4619863..4620792 | + | 930 | WP_000027706.1 | formate dehydrogenase accessory protein FdhE | - |
PL330_RS21935 (4621122) | 4621122..4621364 | - | 243 | WP_001087409.1 | protein YiiF | - |
PL330_RS21940 (4621583) | 4621583..4621801 | - | 219 | WP_001295676.1 | CopG family transcriptional regulator | - |
PL330_RS21945 (4622406) | 4622406..4622696 | - | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
PL330_RS21950 (4622697) | 4622697..4623008 | - | 312 | WP_000897305.1 | hypothetical protein | Toxin |
PL330_RS21955 (4623237) | 4623237..4624145 | + | 909 | WP_001162704.1 | alpha/beta hydrolase | - |
PL330_RS21960 (4624209) | 4624209..4625150 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
PL330_RS21965 (4625195) | 4625195..4625632 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
PL330_RS21970 (4625629) | 4625629..4626501 | - | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
PL330_RS21975 (4626495) | 4626495..4627094 | - | 600 | WP_001295269.1 | glucose-1-phosphatase | - |
PL330_RS21980 (4627193) | 4627193..4627978 | - | 786 | WP_000059678.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T268696 WP_000897305.1 NZ_CP116411:c4623008-4622697 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|